CoraLite® Plus 488-conjugated ANK3 Polyclonal antibody

• 

  IF Staining of mouse brain using CL488-27766

  Immunofluorescent analysis of (4% PFA) fixed mouse brain tissue using CoraLite® Plus 488 ANK3 antibody (CL488-27766) at dilution of 1:200.

ANK3 Polyclonal Antibody for IF-P

Cat No. CL488-27766

Host / Isotype

Rabbit / IgG

Reactivity

Human, Mouse

Applications

IF-P

Synonyms

ANK 3, ANK3, Ankyrin 3, ANKYRIN G, FLJ45464

---

Tested Applications

• Positive IF-P detected in: mouse brain tissue

Recommended dilution

• Immunofluorescence (IF)-P: IF-P : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-27766 targets ANK3 in IF-P applications and shows reactivity with Human, Mouse samples.

• Tested Reactivity: Human, Mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag26948

  Product name: Recombinant human ANK3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 3668-3870 aa of NM_001149

  Sequence: METNLERNVETPTVEPNPSIPTSGECQEGTSSSGSLEKSAAATNTSKVDPKLRTPIKMGISASTMTMKKEGPGEITDKIEAVMTSCQGLENETITMISNTANSQMGVRPHEKHDFQKDNFNNNNNLDSSTIQTDNIMSNIVLTEHSAPTCTTEKDNPVKVSSGKKTGVLQGHCVRDKQKVLGEQQKTKELIGIRQKSKLPIKAT

• Full Name: ankyrin 3, node of Ranvier (ankyrin G)
• Calculated Molecular Weight: 480 kDa
• GenBank Accession Number: NM_001149
• Gene Symbol: ANK3
• Gene ID (NCBI): 288
• RRID: AB_3672817
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q12955
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

ANK3 is associated with neurodevelopment and neuronal function. It has been reported that ANK3 plays a key role in bipolar disorder. ANK3 is expressed in brain at a high level. There are several isoforms of ANK3 associated with different tissue expression and function.