APC1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• APC1 Polyclonal antibody, PBS Only (21748-1-PBS)

• 

  WB analysis of HeLa using 21748-1-AP (same clone as 21748-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 21748-1-AP (APC1 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 21748-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 21748-1-AP (same clone as 21748-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 21748-1-AP (APC1 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 21748-1-PBS in a different storage buffer formulation.

• 

  WB analysis of K-562 using 21748-1-AP (same clone as 21748-1-PBS)

  K-562 cells were subjected to SDS PAGE followed by western blot with 21748-1-AP (APC1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 21748-1-PBS in a different storage buffer formulation.

• 

  WB analysis of Transfected HEK-293 using 21748-1-AP (same clone as 21748-1-PBS)

  Transfected HEK-293 cells were subjected to SDS PAGE followed by western blot with 21748-1-AP (ANAPC1 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 21748-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HT-1080 using 21748-1-AP (same clone as 21748-1-PBS)

  HT-1080 cells were subjected to SDS PAGE followed by western blot with 21748-1-AP (APC1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 21748-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HEK-293 using 21748-1-AP (same clone as 21748-1-PBS)

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 21748-1-AP (APC1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 21748-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse brain using 21748-1-AP (same clone as 21748-1-PBS)

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 21748-1-AP (APC1 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 21748-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse testis using 21748-1-AP (same clone as 21748-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 21748-1-AP (APC1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 21748-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse testis using 21748-1-AP (same clone as 21748-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 21748-1-AP (APC1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 21748-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human cervical cancer using 21748-1-AP (same clone as 21748-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human cervical cancer using 21748-1-AP (APC1 antibody) at dilution of 1:100 (under 10x lens). This data was developed using the same antibody clone with 21748-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human cervical cancer using 21748-1-AP (same clone as 21748-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human cervical cancer using 21748-1-AP (APC1 antibody) at dilution of 1:100 (under 40x lens). This data was developed using the same antibody clone with 21748-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human stomach using 21748-1-AP (same clone as 21748-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human stomach using 21748-1-AP (APC1 antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 21748-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human stomach using 21748-1-AP (same clone as 21748-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human stomach using 21748-1-AP (APC1 antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 21748-1-PBS in a different storage buffer formulation.

APC1 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 21748-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

ANAPC1, Anaphase-promoting complex subunit 1, Apc 1, Mitotic checkpoint regulator, Testis-specific gene 24 protein

---

Product Information

21748-1-PBS targets APC1 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag13399

  Product name: Recombinant human ANAPC1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1596-1944 aa of BC104902

  Sequence: STDNRYHLQALRHLYVLAAEPRLLVPVDVDTNTPCYALLEVTYKGTQWYEQTKEELMAPTLLPELHLLKQIKVKGPRYWELLIDLSKGTQHLKSILSKDGVLYVKLRAGQLSYKEDPMGWQSLLAQTVANRNSEARAFKPETISAFTSDPALLSFAEYFCKPTVNMGQKQEILDLFSSVLYECVTQETPEMLPAYIAMDQAIRRLGRREMSETSELWQIKLVLEFFSSRSHQERLQNHPKRGLFMNSEFLPVVKCTIDNTLDQWLQVGGDMCVHAYLSGQPLEESQLSMLACFLVYHSVPAPQHLPPIGLEGSTSFAELLFKFKQLKMPVRALLRLAPLLLGNPQPMVM

• Full Name: anaphase promoting complex subunit 1
• Calculated Molecular Weight: 1944 aa, 217 kDa
• Observed Molecular Weight: 200-210 kDa
• GenBank Accession Number: BC104902
• Gene Symbol: APC1
• Gene ID (NCBI): 64682
• RRID: AB_10733241
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9H1A4
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.