• Featured Product
  • KD/KO Validated

PE-conjugated APOE Monoclonal antibody

APOE Monoclonal Antibody for
Cat No. PE-66830
Clone No.1B2C9

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse

Applications

ApolipoproteinE, apolipoprotein E, apoe4, Apo-E, Apo E

Formulation:  PBS, Azide, BSA
PBS, Azide, BSA
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

PE-66830 targets APOE in applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag28186

Product name: Recombinant human APOE protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 66-317 aa of BC003557

Sequence: QEELLSSQVTQELRALMDETMKELKAYKSELEEQLTPVAEETRARLSKELQAAQARLGADMEDVCGRLVQYRGEVQAMLGQSTEELRVRLASHLRKLRKRLLRDADDLQKRLAVYQAGAREGAERGLSAIRERLGPLVEQGRVRAATVGSLAGQPLQERAQAWGERLRARMEEMGSRTRDRLDEVKEQVAEVRAKLEEQAQQIRLQAEAFQARLKSWFEPLVEDMQRQWAGLVEKVQAAVGTSAAPVPSDNH

Predict reactive species
Full Name Apolipoprotein E
Calculated Molecular Weight 36 kDa
Observed Molecular Weight 34-36 kDa
GenBank Accession NumberBC003557
Gene Symbol APOE
Gene ID (NCBI) 348
Conjugate PE Fluorescent Dye
Excitation/Emission Maxima Wavelengths496 nm, 565 nm / 578 nm
Excitation LaserBlue Laser (488 nm), Green Laser (532 nm), Yellow-Green Laser (561 nm)
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP02649
Storage Buffer PBS with 0.09% sodium azide and 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

The apolipoprotein E (APOE) is a 299-amino acid polypeptide that mediates the binding, internalization, and catabolism of lipoprotein particles, and also serve as a ligand for the LDL (APO B/E) receptor and for the specific APOE receptor (chylomicron remnant) of hepatic tissues. The very strong association of the APOE ɛ4 allele with AD risk and its role in the accumulation of amyloid β in brains of people and animal models solidify the biological relevance of APOE isoforms but do not provide mechanistic insight.

Loading...
||
New chat

Able

正在加载,请稍候...