• Featured Product
  • KD/KO Validated

CoraLite® Plus 488-conjugated APOL1-Specific Monoclonal antibody

APOL1-Specific Monoclonal Antibody for IF/ICC
Cat No. CL488-66124
Clone No.1G12D11

Host / Isotype

Mouse / IgG2a

Reactivity

human

Applications

IF/ICC

APO L, APOL, APOL I, APOL1, APOL1-Specific, Apolipoprotein L, Apolipoprotein L I, apolipoprotein L, 1, Apolipoprotein L1

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHepG2 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-66124 targets APOL1-Specific in IF/ICC applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Mouse / IgG2a
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag2016

Product name: Recombinant human APOL1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-238 aa of BC017331

Sequence: MEGAALLRVSVLCIWMSALFLGVGVRAEEAGARVQQNVPSGTDTGDPQSKPLGDWAAGTMDPESSIFIEDAIKYFKEKVSTQNLLLLLTDNEAWNGFVAAAELPRNEADELRKALDNLARQMIMKDKNWHDKGQQYRNWFLKEFPRLKSELEDNIRRLRALADGVQKVHKGTTIANVVSGSLSISSGILTLVGMGLAPFTEGGSLVLLEPGMELGITAALTGITSSTMDYGKKWWTQA

Predict reactive species
Full Name apolipoprotein L, 1
Calculated Molecular Weight 44 kDa
Observed Molecular Weight 39-45 kDa
GenBank Accession NumberBC017331
Gene Symbol APOL1
Gene ID (NCBI) 8542
RRIDAB_2883265
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
Excitation LaserBlue laser (488 nm)
FormLiquid
Purification MethodProtein A purification
UNIPROT IDO14791
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Human apolipo-protein L1 (APOL1) is a minor component of plasma high density lipoprotein (HDL) particles, acting as an interacting protein of apolipoprotein A1 (ApoA1). The human ApoL protein family was thought to be predominantly involved in lipid transport and metabolism. APOL1 is also involved in host innate immunity against Trypanosoma parasites. Once activated, APOL1 can lyse the parasite and protect human from infection. Genetic variants in APOL1 gene, which are found in African ancestry with high frequency, associate with chronic kidney disease, like focal segmental glomerulosclerosis (FSGS), HIV-associated nephropathy (HIVAN), and hypertensive nephropathy. APOL1 share structural and functional similarities with proteins of the Bcl-2 family and may has roles in apoptosis and autophagy. It is notable that APOL1 exists only in human and a few other primate species, and mouse does not express an APOL1 orthologue. This antibody recognizes the endogenous ApoL1 of 39-45 kDa in blood lysate.

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 APOL1-Specific antibody CL488-66124Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...