AQP2 Recombinant monoclonal antibody, PBS Only (Capture)

AQP2 Uni-rAb® Recombinant Antibody for WB, IHC, Cytometric bead array, Indirect ELISA
Cat No. 85402-1-PBS
Clone No.242886B8

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, Cytometric bead array, Indirect ELISA

Aquaporin 2, AQP-2, Aquaporin2

Formulation:  PBS Only
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

85402-1-PBS targets AQP2 as part of a matched antibody pair:

MP01925-1: 85402-1-PBS capture and 85402-2-PBS detection (validated in Cytometric bead array)

MP01925-2: 85402-1-PBS capture and 85402-3-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag29931

Product name: Recombinant human AQP2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 207-271 aa of NM_000486

Sequence: GPLVGAILGSLLYNYVLFPPAKSLSERLAVLKGLEPDTDWEEREVRRRQSVELHSPQSLPRGTKA

Predict reactive species
Full Name aquaporin 2 (collecting duct)
Calculated Molecular Weight 29 kDa
Observed Molecular Weight28-29 kDa, 35-38 kDa
GenBank Accession NumberNM_000486
Gene Symbol AQP2
Gene ID (NCBI) 359
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP41181
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

AQP2 (Aquaporin2) is a water channel protein that is widely distributed among mammalian tissues and plays a major role in water homeostasis. AQP2 is mainly found in the apical cell membranes of the kidney's collecting duct cells and is critical for urinary concentration. AQP2 can be glycosylated and this antibody recognizes the 28-29 kDa non-glycosylated as well as the 35-40 kDa glycosylated forms of AQP2.

Loading...
||
New chat Able
正在加载,请稍候...