CoraLite® Plus 647-conjugated AQP2 Recombinant monoclonal antibody

• 

  IF Staining of mouse kidney using CL647-85402

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse kidney tissue using CoraLite® Plus 647 AQP2 antibody (CL647-85402, Clone: 242886B8 ) at dilution of 1:200. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

AQP2 Uni-rAb^® Recombinant Antibody for IF-P

Cat No. CL647-85402

Clone No.242886B8

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IF-P

Synonyms

Aquaporin 2, AQP-2, Aquaporin2

---

Tested Applications

• Positive IF-P detected in: mouse kidney tissue

Recommended dilution

• Immunofluorescence (IF)-P: IF-P : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL647-85402 targets AQP2 in IF-P applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag29931

  Product name: Recombinant human AQP2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 207-271 aa of NM_000486

  Sequence: GPLVGAILGSLLYNYVLFPPAKSLSERLAVLKGLEPDTDWEEREVRRRQSVELHSPQSLPRGTKA

• Full Name: aquaporin 2 (collecting duct)
• Calculated Molecular Weight: 29 kDa
• Observed Molecular Weight: 28-29 kDa, 35-38 kDa
• GenBank Accession Number: NM_000486
• Gene Symbol: AQP2
• Gene ID (NCBI): 359
• Conjugate: CoraLite® Plus 647 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 654 nm / 674 nm
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P41181
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

AQP2 (Aquaporin2) is a water channel protein that is widely distributed among mammalian tissues and plays a major role in water homeostasis. AQP2 is mainly found in the apical cell membranes of the kidney's collecting duct cells and is critical for urinary concentration. AQP2 can be glycosylated and this antibody recognizes the 28-29 kDa non-glycosylated as well as the 35-40 kDa glycosylated forms of AQP2.