ARD1A Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• ARD1A Polyclonal antibody, PBS Only (14803-1-PBS)

• 

  WB analysis using 14803-1-AP (same clone as 14803-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 14803-1-AP (ARD1A antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 14803-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse spleen using 14803-1-AP (same clone as 14803-1-PBS)

  mouse spleen tissue were subjected to SDS PAGE followed by western blot with 14803-1-AP (ARD1A Antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 14803-1-PBS in a different storage buffer formulation.

• 

  IP experiment of MCF-7 using 14803-1-AP (same clone as 14803-1-PBS)

  IP result of anti-ARD1A (IP:14803-1-AP, 4ug; Detection:14803-1-AP 1:500) with MCF-7 cells lysate 3200ug. This data was developed using the same antibody clone with 14803-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 14803-1-AP (same clone as 14803-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 14803-1-AP (ARD1A antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 14803-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 14803-1-AP (same clone as 14803-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 14803-1-AP (ARD1A antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 14803-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 14803-1-AP (same clone as 14803-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using ARD1A antibody (14803-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-phalloidin (red). This data was developed using the same antibody clone with 14803-1-PBS in a different storage buffer formulation.

ARD1A Polyclonal Antibody for WB, IHC, IF/ICC, IP, Indirect ELISA

Cat No. 14803-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, Indirect ELISA

Synonyms

---

Product Information

14803-1-PBS targets ARD1A in WB, IHC, IF/ICC, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag6519

  Product name: Recombinant human ARD1A protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-235 aa of BC000308

  Sequence: MNIRNARPEDLMNMQHCNLLCLPENYQMKYYFYHGLSWPQLSYIAEDENGKIVGYVLAKMEEDPDDVPHGHITSLAVKRSHRRLGLAQKLMDQASRAMIENFNAKYVSLHVRKSNRAALHLYSNTLNFQISEVEPKYYADGEDAYAMKRDLTQMADELRRHLELKEKGRHVVLGAIENKVESKGNSPPSSGEACREEKGLAAEDSGGDSKDLSEVSETTESTDVKDSSEASDSAS

• Full Name: ARD1 homolog A, N-acetyltransferase (S. cerevisiae)
• Calculated Molecular Weight: 26 kDa
• Observed Molecular Weight: 26 kDa
• GenBank Accession Number: BC000308
• Gene Symbol: ARD1A
• Gene ID (NCBI): 8260
• RRID: AB_1557262
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P41227
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.