• Featured Product
  • KD/KO Validated

ARF4 Monoclonal antibody, PBS Only

ARF4 Monoclonal Antibody for WB, IHC, IF/ICC, FC (Intra), Indirect ELISA
Cat No. 68204-1-PBS
Clone No.2A4B8

Host / Isotype

Mouse / IgG2b

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, FC (Intra), Indirect ELISA

2A4B8, ADP ribosylation factor 4, ADP-ribosylation factor 4, ARF2

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

68204-1-PBS targets ARF4 in WB, IHC, IF/ICC, FC (Intra), Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Mouse / IgG2b
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag25522

Product name: Recombinant human ARF4 protein

Source: e coli.-derived, PET30a

Tag: 6*His

Domain: 1-180 aa of BC003364

Sequence: MGLTISSLFSRLFGKKQMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNICFTVWDVGGQDRIRPLWKHYFQNTQGLIFVVDSNDRERIQEVADELQKMLLVDELRDAVLLLFANKQDLPNAMAISEMTDKLGLQSLRNRTWYVQATCATQGTGLYEGLDWLSNELSKR

Predict reactive species
Full Name ADP-ribosylation factor 4
Calculated Molecular Weight 180 aa, 21 kDa
Observed Molecular Weight18 kDa
GenBank Accession NumberBC003364
Gene Symbol ARF4
Gene ID (NCBI) 378
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP18085
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

ARF4, also named as ARF2, belongs to the small GTPase superfamily and Arf family. ADP-ribosylation factors (ARFs) are members of the ARF family of GTP-binding proteins of the Ras superfamily, with 20 kDa protein size. ARFs bind and regulate GTP/GDP cycle by alternating between the active GTP-bound and inactive GDP-bound conformations. ARF family proteins are essential and ubiquitous in eukaryotes. Six highly conserved members of the family have been identified in mammalian cells. They function in vesicular traffic and actin remodelling and other bioprocesses in cells. ARF4 and ARF5 are class II ARFs. Their function are not fully described. (PMID: 7759471, PMID: 16042562). This antibody can bind ARFs for the close sequences.

Loading...
||
New chat Able
正在加载,请稍候...