• Featured Product
  • KD/KO Validated

ARF4 Monoclonal antibody

ARF4 Monoclonal Antibody for WB, IHC, IF/ICC, FC (Intra), ELISA
Cat No. 68204-1-Ig
Clone No.2A4B8

Host / Isotype

Mouse / IgG2b

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, FC (Intra), ELISA

ARF2, ADP-ribosylation factor 4, ADP ribosylation factor 4, 2A4B8

Formulation:  PBS and Azide
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inLNCaP cells, HEK-293 cells, rat brain tissue, A549 cells, mouse brain tissue, HeLa cells, HepG2 cells, Jurkat cells
Positive IHC detected inhuman stomach cancer tissue, human liver tissue, human pancreas cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHepG2 cells
Positive FC (Intra) detected inK-562 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunohistochemistry (IHC)IHC : 1:1000-1:4000
Immunofluorescence (IF)/ICCIF/ICC : 1:400-1:1600
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Published Applications

WBSee 1 publications below

Product Information

68204-1-Ig targets ARF4 in WB, IHC, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityrat
Host / Isotype Mouse / IgG2b
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag25522

Product name: Recombinant human ARF4 protein

Source: e coli.-derived, PET30a

Tag: 6*His

Domain: 1-180 aa of BC003364

Sequence: MGLTISSLFSRLFGKKQMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNICFTVWDVGGQDRIRPLWKHYFQNTQGLIFVVDSNDRERIQEVADELQKMLLVDELRDAVLLLFANKQDLPNAMAISEMTDKLGLQSLRNRTWYVQATCATQGTGLYEGLDWLSNELSKR

Predict reactive species
Full Name ADP-ribosylation factor 4
Calculated Molecular Weight 180 aa, 21 kDa
Observed Molecular Weight18 kDa
GenBank Accession NumberBC003364
Gene Symbol ARF4
Gene ID (NCBI) 378
RRIDAB_2935292
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP18085
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ARF4, also named as ARF2, belongs to the small GTPase superfamily and Arf family. ADP-ribosylation factors (ARFs) are members of the ARF family of GTP-binding proteins of the Ras superfamily, with 20 kDa protein size. ARFs bind and regulate GTP/GDP cycle by alternating between the active GTP-bound and inactive GDP-bound conformations. ARF family proteins are essential and ubiquitous in eukaryotes. Six highly conserved members of the family have been identified in mammalian cells. They function in vesicular traffic and actin remodelling and other bioprocesses in cells. ARF4 and ARF5 are class II ARFs. Their function are not fully described. (PMID: 7759471, PMID: 16042562). This antibody can bind ARFs for the close sequences.

Protocols

Product Specific Protocols
WB protocol for ARF4 antibody 68204-1-IgDownload protocol
IHC protocol for ARF4 antibody 68204-1-IgDownload protocol
IF protocol for ARF4 antibody 68204-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
ratWB

Cell Signal

Targeting CDK1 inhibits Golgi apparatus stress-mediated neuroinflammation and neuronal apoptosis after intracerebral hemorrhage by modulating GRASP55 phosphorylation

Authors - Xiaobo Zhang
Loading...
||
New chat Able
正在加载,请稍候...