ARFGEF2 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• ARFGEF2 Polyclonal antibody, PBS Only (31277-1-PBS)

• 

  WB analysis using 31277-1-AP (same clone as 31277-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 31277-1-AP (ARFGEF2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 31277-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human stomach cancer using 31277-1-AP (same clone as 31277-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 31277-1-AP (ARFGEF2 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 31277-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human stomach cancer using 31277-1-AP (same clone as 31277-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 31277-1-AP (ARFGEF2 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 31277-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human intrahepatic cholangiocarcinoma using 31277-1-AP (same clone as 31277-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human intrahepatic cholangiocarcinoma tissue slide using 31277-1-AP (ARFGEF2 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 31277-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human intrahepatic cholangiocarcinoma using 31277-1-AP (same clone as 31277-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human intrahepatic cholangiocarcinoma tissue slide using 31277-1-AP (ARFGEF2 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 31277-1-PBS in a different storage buffer formulation.

ARFGEF2 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 31277-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, Indirect ELISA

Synonyms

BIG2, Brefeldin A inhibited GEP 2, ARFGEP2

---

Product Information

31277-1-PBS targets ARFGEF2 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag35396

  Product name: Recombinant human ARFGEF2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 211-370 aa of BC050449

  Sequence: PIQSKPQSPVIQAAAVSPKFVRLKHSQAQSKPTTPEKTDLTNGEHARSDSGKVSTENGDAPRERGSSLSGTDDGAQEVVKDILEDVVTSAIKEAAEKHGLTEPERVLGELECQECAIPPGVDENSQTNGIADDRQSLSSADNLESDAQGHQVAARFSHVL

• Full Name: ADP-ribosylation factor guanine nucleotide-exchange factor 2 (brefeldin A-inhibited)
• Observed Molecular Weight: 202 kDa
• GenBank Accession Number: BC050449
• Gene Symbol: ARFGEF2
• Gene ID (NCBI): 10564
• RRID: AB_3669925
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9Y6D5
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

ADP-ribosylation factors (ARFs) play an important role in intracellular vesicular trafficking. ARFGEF2 is involved in the activation of ARFs by accelerating replacement of bound GDP with GTP and is involved in Golgi transport. ARFGEF2 contains a Sec7 domain, which may be responsible for its guanine-nucleotide exchange activity and also brefeldin A inhibition.