ARH Monoclonal antibody, PBS Only

• 

  WB analysis using 66932-2-Ig (same clone as 66932-2-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 66932-2-Ig (ARH antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated Alpha Tubulin Monoclonal antibody (HRP-66031) as loading control. This data was developed using the same antibody clone with 66932-2-PBS in a different storage buffer formulation.

• 

  WB analysis using 66932-2-Ig (same clone as 66932-2-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 66932-2-Ig (LDLRAP1 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66932-2-PBS in a different storage buffer formulation.

• 

  FC experiment of HeLa using 66932-2-Ig (same clone as 66932-2-PBS)

  1x10^6 HeLa cells were intracellularly stained with 0.8 ug ARH Monoclonal antibody (66932-2-Ig, Clone:1D1B11) and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L) (SA00013-1)(red), or 0.8 ug Mouse IgG2b isotype control Mouse McAb (66360-3-Ig, Clone: 11B8C4) (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer (PF00011-C). This data was developed using the same antibody clone with 66932-2-PBS in a different storage buffer formulation.

ARH Monoclonal Antibody for Indirect ELISA, WB

Cat No. 66932-2-PBS

Clone No.1D1B11

Host / Isotype

Mouse / IgG2b

Reactivity

rat, human

Applications

Indirect ELISA, WB

Synonyms

LDLRAP1, FHCB2, FHCB1, ARH2, ARH1

---

Product Information

66932-2-PBS targets ARH in Indirect ELISA, WB applications and shows reactivity with rat, human samples.

• Tested Reactivity: rat, human
• Host / Isotype: Mouse / IgG2b
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag28608

  Product name: Recombinant human LDLRAP1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-308 aa of BC029770

  Sequence: MDALKSAGRALIRSPSLAKQSWGGGGRHRKLPENWTDTRETLLEGMLFSLKYLGMTLVEQPKGEELSAAAIKRIVATAKASGKKLQKVTLKVSPRGIILTDNLTNQLIENVSIYRISYCTADKMHDKVFAYIAQSQHNQSLECHAFLCTKRKMAQAVTLTVAQAFKVAFEFWQVSKEEKEKRDKASQEGGDVLGARQDCTPPLKSLVATGNLLDLEETAKAPLSTVSANTTNMDEVPRPQALSGSSVVWELDDGLDEAFSRLAQSRTNPQVLDTGLTAQDMHYAQCLSPVDWDKPDSSGTEQDDLFSF

• Full Name: low density lipoprotein receptor adaptor protein 1
• Calculated Molecular Weight: 308 aa, 34 kDa
• Observed Molecular Weight: 34 kDa
• GenBank Accession Number: BC029770
• Gene Symbol: ARH
• Gene ID (NCBI): 26119
• RRID: AB_2882258
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q5SW96
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.