ARHGAP27 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• ARHGAP27 Polyclonal antibody, PBS Only (22077-1-PBS)

• 

  WB analysis of A549 using 22077-1-AP (same clone as 22077-1-PBS)

  A549 cells were subjected to SDS PAGE followed by western blot with 22077-1-AP (ARHGAP27 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 22077-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 22077-1-AP (same clone as 22077-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 22077-1-AP (ARHGAP27 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 22077-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 22077-1-AP (same clone as 22077-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 22077-1-AP (ARHGAP27 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 22077-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human pancreas using 22077-1-AP (same clone as 22077-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human pancreas tissue slide using 22077-1-AP (ARHGAP27 antibody) at dilution of 1:200 (under 10x lens). This data was developed using the same antibody clone with 22077-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human pancreas using 22077-1-AP (same clone as 22077-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human pancreas tissue slide using 22077-1-AP (ARHGAP27 antibody) at dilution of 1:200 (under 40x lens). This data was developed using the same antibody clone with 22077-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 22077-1-AP (same clone as 22077-1-PBS)

  Immunofluorescent analysis of (-20℃ Ethanol) fixed HeLa cells using 22077-1-AP (ARHGAP27 antibody) at dilution of 1:25 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 22077-1-PBS in a different storage buffer formulation.

ARHGAP27 Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 22077-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

---

Product Information

22077-1-PBS targets ARHGAP27 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag17225

  Product name: Recombinant human ARHGAP27 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-300 aa of BC101388

  Sequence: MQPGLSPGSPGDPRPPTPETDYPESLTSYPEEDYSPVGSFGEPGPTSPLTTPPGWSCHVSQDKQMLYTNHFTQEQWVRLEDPHGKPYFYNPEDSSVRWELPQVPVPAPRSIHKSSQDGDTPAQASPPEEKVPAELDEVGSWEEVSPATAAVRTKTLDKAGVLHRTKTADKGKRLRKKHWSASWTVLEGGVLTFFKDSKTSAAGGLRQPSKFSTPEYTVELRGATLSWAPKDKSSRKNVLELRSRDGSEYLIQHDSEAIISTWHKAIAQGIQELSAELPPEESESSRVDFGSSERLGSWQE

• Full Name: Rho GTPase activating protein 27
• Calculated Molecular Weight: 548 aa, 62 kDa
• Observed Molecular Weight: 98 kDa
• GenBank Accession Number: BC101388
• Gene Symbol: ARHGAP27
• Gene ID (NCBI): 201176
• RRID: AB_2878985
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q6ZUM4
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.