ARHGEF16 Monoclonal antibody, PBS Only

• 

  WB analysis using 67975-1-Ig (same clone as 67975-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67975-1-Ig (ARHGEF16 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67975-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HepG2 using 67975-1-Ig (same clone as 67975-1-PBS)

  HepG2 cells were subjected to SDS PAGE followed by western blot with 67975-1-Ig (ARHGEF16 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67975-1-PBS in a different storage buffer formulation.

• 

  WB analysis of MCF-7 using 67975-1-Ig (same clone as 67975-1-PBS)

  MCF-7 cells were subjected to SDS PAGE followed by western blot with 67975-1-Ig (ARHGEF16 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67975-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 67975-1-Ig (same clone as 67975-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using ARHGEF16 antibody (67975-1-Ig, Clone: 1D8E3 ) at dilution of 1:400 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Mouse Recombinant Secondary Antibody (H+L) (RGAM002). This data was developed using the same antibody clone with 67975-1-PBS in a different storage buffer formulation.

ARHGEF16 Monoclonal Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 67975-1-PBS

Clone No.1D8E3

Host / Isotype

Mouse / IgG2b

Reactivity

human

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

NBR, GEF16, Ephexin-4, EPHEXIN4, Ephexin 4

---

Product Information

67975-1-PBS targets ARHGEF16 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Mouse / IgG2b
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag28675

  Product name: Recombinant human ARHGEF16 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-421 aa of BC002681

  Sequence: MFEILTSEFSYQHSLSILVEEFLQSKELRATVTQMEHHHLFSNILDVLGASQRFFEDLEQRHKAQVLVEDISDILEEHAEKYFHPYIAYCSNEVYQQRTLQKLISSNAAFREALREIERRPACGGLPMLSFLILPMQRVTRLPLLMDTLCLKTQGHSERYKAASRALKAISKLVRQCNEGAHRMERMEQMYTLHTQLDFSKVKSLPLISASRWLLKRGELFLVEETGLFRKIASRPTCYLFLFNDVLVVTKKKSEESYMVQDYAQMNHIQVEKIEPSELPLPGGGNRSSSVPHPFQVTLLRNSEGRQEQLLLSSDSASDRARWIVALTHSERQWQGLSSKGDLPQVEITKAFFAKQADEVTLQQADVVLVLQQEDGWLYGERLRDGETGWFPEDFARFITSRVAVEGNVRRMERLRVETDV

• Full Name: Rho guanine exchange factor (GEF) 16
• Calculated Molecular Weight: 80 kDa
• Observed Molecular Weight: 80 kDa
• GenBank Accession Number: BC002681
• Gene Symbol: ARHGEF16
• Gene ID (NCBI): 27237
• RRID: AB_2918724
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q5VV41
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Small GTPases of the Rho family are critical regulators of various cellular functions including actin cytoskeleton organization, activation of kinase cascades, mitogenesis, transcriptional activation and stimulation of DNA synthesis. Rho proteins cycle between a biologically active GTP-bound state and an inactive GDP-bound state. Rho guanine nucleotide exchange factor (GEF) has a crucial role in activating small GTPase by exchange GDP for GTP. ARGEF16 is one of the multiple GEF members. Although the specific function of this protein is not known yet, it is thought to be involved in protein-protein and protein-lipid interactions.