CoraLite® Plus 488-conjugated ARID1B Recombinant monoclonal antibody

• 

  IF Staining of HepG2 using CL488-82979

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using CoraLite® Plus 488 ARID1B antibody (CL488-82979, Clone: 230222G4 ) at dilution of 1:200, CL594-phalloidin (red).

ARID1B Uni-rAb^® Recombinant Antibody for IF/ICC

Cat No. CL488-82979

Clone No.230222G4

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF/ICC

Synonyms

230222G4, BAF250b, BRIGHT, DAN15, ELD/OSA1

---

Tested Applications

• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-82979 targets ARID1B in IF/ICC applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag30643

  Product name: Recombinant human ARID1B protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1370-1508 aa of NM_017519

  Sequence: PAKRHEGDMYNMQYSSQQQEMYNQYGGSYSGPDRRPIQGQYPYPYSRERMQGPGQIQTHGIPPQMMGGPLQSSSSEGPQQNMWAARNDMPYPYQNRQGPGGPTQAPPYPGMNRTDDMMVPDQRINHESQWPSHVSQRQP

• Full Name: AT rich interactive domain 1B (SWI1-like)
• Calculated Molecular Weight: 236 kDa
• GenBank Accession Number: NM_017519
• Gene Symbol: ARID1B
• Gene ID (NCBI): 57492
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Excitation Laser: Blue laser (488 nm)
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q8NFD5
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.