ARL8A/ARL8B Monoclonal antibody, PBS Only

• 

  WB analysis using 68186-1-Ig (same clone as 68186-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 68186-1-Ig (ARL8A/ARL8B antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated GAPDH Monoclonal antibody (HRP-60004) as loading control. This data was developed using the same antibody clone with 68186-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 68186-1-Ig (same clone as 68186-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 68186-1-Ig (ARL8A/ARL8B antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68186-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 68186-1-Ig (same clone as 68186-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 68186-1-Ig (ARL8A antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68186-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human placenta using 68186-1-Ig (same clone as 68186-1-PBS)

  human placenta tissue were subjected to SDS PAGE followed by western blot with 68186-1-Ig (ARL8A antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68186-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 68186-1-Ig (same clone as 68186-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 68186-1-Ig (ARL8A antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68186-1-PBS in a different storage buffer formulation.

• 

  IF Staining of C6 using 68186-1-Ig (same clone as 68186-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed C6 cells using ARL8A/ARL8B antibody (68186-1-Ig, Clone: 2F4C3 ) at dilution of 1:800 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L), CL594-Phalloidin (red). This data was developed using the same antibody clone with 68186-1-PBS in a different storage buffer formulation.

• 

  IF Staining of Neuro-2a using 68186-1-Ig (same clone as 68186-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed Neuro-2a cells using ARL8A/ARL8B antibody (68186-1-Ig, Clone: 2F4C3 ) at dilution of 1:800 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 68186-1-PBS in a different storage buffer formulation.

• 

  IF Staining of A549 using 68186-1-Ig (same clone as 68186-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed A549 cells using ARL8A/ARL8B antibody (68186-1-Ig, Clone: 2F4C3 ) at dilution of 1:2000 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Mouse Recombinant Secondary Antibody (H+L) (RGAM002), CL594-Phalloidin (red). This data was developed using the same antibody clone with 68186-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HEK-293 using 68186-1-Ig (same clone as 68186-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HEK-293 cells using ARL8A/ARL8B antibody (68186-1-Ig, Clone: 2F4C3 ) at dilution of 1:2000 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Mouse Recombinant Secondary Antibody (H+L) (RGAM002), CL594-Phalloidin (red). This data was developed using the same antibody clone with 68186-1-PBS in a different storage buffer formulation.

ARL8A/ARL8B Monoclonal Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 68186-1-PBS

Clone No.2F4C3

Host / Isotype

Mouse / IgG2a

Reactivity

human, mouse, rat, rabbit

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

ARL8A, GIE2, ARL10B, ADP-ribosylation factor-like protein 8A, ADP-ribosylation factor-like protein 10B

---

Product Information

68186-1-PBS targets ARL8A/ARL8B in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat, rabbit samples.

• Tested Reactivity: human, mouse, rat, rabbit
• Host / Isotype: Mouse / IgG2a
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag10758

  Product name: Recombinant human ARL8A protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-186 aa of BC015408

  Sequence: MIALFNKLLDWFKALFWKEEMELTLVGLQYSGKTTFVNVIASGQFNEDMIPTVGFNMRKITKGNVTIKLWDIGGQPRFRSMWERYCRGVSAIVYMVDAADQEKIEASKNELHNLLDKPQLQGIPVLVLGNKRDLPGALDEKELIEKMNLSAIQDREICCYSISCKEKDNIDITLQWLIQHSKSRRS

• Full Name: ADP-ribosylation factor-like 8A
• Calculated Molecular Weight: 186 aa, 21 kDa
• Observed Molecular Weight: 18 kDa, 21 kDa
• GenBank Accession Number: BC015408
• Gene Symbol: ARL8A
• Gene ID (NCBI): 127829
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q96BM9
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

ARL8A (ADP-ribosylation factor-like protein 8A) is also named as ARL10B, GIE2 and belongs to the small GTPase superfamily. ARL8A is localized to lysosomes in mammalian cells (PMID: 16537643). In neurons, ARL8A mediates the anterograde axonal long-range transport of presynaptic lysosome-related vesicles that are required for presynaptic biogenesis and synaptic function. ARL8A is upregulated in many cancers such as endometrial cancer (PMID: 32070877), colorectal cancer (PMID: 30546056) and inflammatory breast cancer (PMID: 27648361), and has been associated with poor survival outcomes. ARL8A/ARL8B can be recognized by this antibody.