ARL8A/ARL8B Monoclonal antibody, PBS Only

ARL8A/ARL8B Monoclonal Antibody for WB, IF/ICC, Indirect ELISA
Cat No. 68186-1-PBS
Clone No.2F4C3

Host / Isotype

Mouse / IgG2a

Reactivity

human, mouse, rat, rabbit

Applications

WB, IF/ICC, Indirect ELISA

ARL8A, GIE2, ARL10B, ADP-ribosylation factor-like protein 8A, ADP-ribosylation factor-like protein 10B

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

68186-1-PBS targets ARL8A/ARL8B in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat, rabbit samples.

Tested Reactivity human, mouse, rat, rabbit
Host / Isotype Mouse / IgG2a
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag10758

Product name: Recombinant human ARL8A protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-186 aa of BC015408

Sequence: MIALFNKLLDWFKALFWKEEMELTLVGLQYSGKTTFVNVIASGQFNEDMIPTVGFNMRKITKGNVTIKLWDIGGQPRFRSMWERYCRGVSAIVYMVDAADQEKIEASKNELHNLLDKPQLQGIPVLVLGNKRDLPGALDEKELIEKMNLSAIQDREICCYSISCKEKDNIDITLQWLIQHSKSRRS

Predict reactive species
Full Name ADP-ribosylation factor-like 8A
Calculated Molecular Weight 186 aa, 21 kDa
Observed Molecular Weight18 kDa, 21 kDa
GenBank Accession NumberBC015408
Gene Symbol ARL8A
Gene ID (NCBI) 127829
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ96BM9
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

ARL8A (ADP-ribosylation factor-like protein 8A) is also named as ARL10B, GIE2 and belongs to the small GTPase superfamily. ARL8A is localized to lysosomes in mammalian cells (PMID: 16537643). In neurons, ARL8A mediates the anterograde axonal long-range transport of presynaptic lysosome-related vesicles that are required for presynaptic biogenesis and synaptic function. ARL8A is upregulated in many cancers such as endometrial cancer (PMID: 32070877), colorectal cancer (PMID: 30546056) and inflammatory breast cancer (PMID: 27648361), and has been associated with poor survival outcomes. ARL8A/ARL8B can be recognized by this antibody.

Loading...
||
New chat Able
正在加载,请稍候...