Filter: AllWBIHC

WB analysis of mouse testis using 25035-1-AP (same clone as 25035-1-PBS)
mouse testis tissue were subjected to SDS PAGE followed by western blot with 25035-1-AP (ARMETL1 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 25035-1-PBS in a different storage buffer formulation.
IHC staining of human liver cancer using 25035-1-AP (same clone as 25035-1-PBS)
Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 25035-1-AP (ARMETL1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 25035-1-PBS in a different storage buffer formulation.
IHC staining of human liver cancer using 25035-1-AP (same clone as 25035-1-PBS)
Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 25035-1-AP (ARMETL1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 25035-1-PBS in a different storage buffer formulation.

CDNF Polyclonal antibody, PBS Only

Name: CDNF Polyclonal antibody, PBS Only
Brand: Proteintech
SKU: 25035-1-PBS

CDNF Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 25035-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, Indirect ELISA

Synonyms

ARMETL1, ARMET like protein 1, ARMET-like protein 1

Formulation: PBS Only

PBS, Azide, Glycerol

Conjugate: Unconjugated

Size/Concentration:

Freight/Packing: -

Quantity

- +

25035-1-PBS targets CDNF in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity	human, mouse
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag18972 Product name: Recombinant human ARMETL1 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 103-187 aa of BC133042 Sequence: MSVHMPAMKICEKLKKLDSQICELKYEKTLDLASVDLRKMRVAELKQILHSWGEECRACAEKTDYVNLIQELAPKYAATHPKTEL Predict reactive species
Full Name	arginine-rich, mutated in early stage tumors-like 1
Calculated Molecular Weight	187 aa, 21 kDa
Observed Molecular Weight	21 kDa
GenBank Accession Number	BC133042
Gene Symbol	ARMETL1
Gene ID (NCBI)	441549
RRID	AB_2879861
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	Q49AH0
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.

Able™