CDNF Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• CDNF Polyclonal antibody, PBS Only (25035-1-PBS)

• 

  WB analysis of mouse testis using 25035-1-AP (same clone as 25035-1-PBS)

  mouse testis tissue were subjected to SDS PAGE followed by western blot with 25035-1-AP (ARMETL1 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 25035-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 25035-1-AP (same clone as 25035-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 25035-1-AP (ARMETL1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 25035-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 25035-1-AP (same clone as 25035-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 25035-1-AP (ARMETL1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 25035-1-PBS in a different storage buffer formulation.

CDNF Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 25035-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, Indirect ELISA

Synonyms

ARMETL1, ARMET like protein 1, ARMET-like protein 1

---

Product Information

25035-1-PBS targets CDNF in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag18972

  Product name: Recombinant human ARMETL1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 103-187 aa of BC133042

  Sequence: MSVHMPAMKICEKLKKLDSQICELKYEKTLDLASVDLRKMRVAELKQILHSWGEECRACAEKTDYVNLIQELAPKYAATHPKTEL

• Full Name: arginine-rich, mutated in early stage tumors-like 1
• Calculated Molecular Weight: 187 aa, 21 kDa
• Observed Molecular Weight: 21 kDa
• GenBank Accession Number: BC133042
• Gene Symbol: ARMETL1
• Gene ID (NCBI): 441549
• RRID: AB_2879861
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q49AH0
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Cerebral dopamine neurotrophic factor (CDNF) is a secreted protein belonging to the mesencephalic astrocyte-derived neurotrophic factor (MANF) family. Unlike classical neurotrophic factors, CDNF is primarily localized in the endoplasmic reticulum and exerts neuroprotective effects through modulating the unfolded protein response (UPR). CDNF has demonstrated potent protective effects on dopaminergic neurons in preclinical models of Parkinson's disease (PD), reducing neuroinflammation and alpha-synuclein aggregation. Its unique mechanism-targeting ER stress rather than receptor tyrosine kinases-offers a promising therapeutic avenue for neurodegenerative disorders. Clinical trials are currently evaluating recombinant human CDNF as a disease-modifying therapy for PD (PMID: 34284712; 37555005; 38290651).