ARSE Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• ARSE Polyclonal antibody, PBS Only (31522-1-PBS)

• 

  IHC staining of mouse liver using 31522-1-AP (same clone as 31522-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 31522-1-AP (ARSE antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 31522-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse liver using 31522-1-AP (same clone as 31522-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 31522-1-AP (ARSE antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 31522-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 31522-1-AP (same clone as 31522-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using ARSE antibody (31522-1-AP) at dilution of 1:400 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002). This data was developed using the same antibody clone with 31522-1-PBS in a different storage buffer formulation.

ARSE Polyclonal Antibody for IHC, IF/ICC, Indirect ELISA

Cat No. 31522-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IHC, IF/ICC, Indirect ELISA

Synonyms

CDPXR, CDPX1, CDPX, ASE, Arylsulfatase E

---

Product Information

31522-1-PBS targets ARSE in IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag24371

  Product name: Recombinant human ARSE protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 524-567 aa of BC130438

  Sequence: HILTPASEPVFYQVMERVQQAVWEHQRTLSPVPLQLDRLGNIWR

• Full Name: arylsulfatase E (chondrodysplasia punctata 1)
• GenBank Accession Number: BC130438
• Gene Symbol: ARSE
• Gene ID (NCBI): 415
• RRID: AB_3670019
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: P51690
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

ARSE (arylsulfatase E), is a member of the sulfatase family. This enzyme is glycosylated post-translationally. Sulfatases, including ARSE, are essential for the correct composition of the bone and cartilage matrix.