Filter: AllWBIHC

WB analysis using 25300-1-AP (same clone as 25300-1-PBS)
Various lysates were subjected to SDS PAGE followed by western blot with 25300-1-AP (ASB14 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 25300-1-PBS in a different storage buffer formulation.
IHC staining of human tonsillitis using 25300-1-AP (same clone as 25300-1-PBS)
Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 25300-1-AP (ASB14 Antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 25300-1-PBS in a different storage buffer formulation.
IHC staining of human tonsillitis using 25300-1-AP (same clone as 25300-1-PBS)
Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 25300-1-AP (ASB14 Antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 25300-1-PBS in a different storage buffer formulation.

ASB14 Polyclonal antibody, PBS Only

Name: ASB14 Polyclonal antibody, PBS Only
Brand: Proteintech
SKU: 25300-1-PBS

ASB14 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 25300-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

ASB 14, ASB-14

Formulation: PBS Only

PBS, Azide, Glycerol

Conjugate: Unconjugated

Size/Concentration:

Freight/Packing: -

Quantity

- +

25300-1-PBS targets ASB14 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity	human, mouse, rat
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag18147 Product name: Recombinant human ASB14 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 366-478 aa of BC114953 Sequence: SNSDLSSVKLLLSAGALPNQDPVNCLQIALRMGNYELISLLLRHGANVNYFCRVNPLHFPSALQYTLKDEVMLRMLLNYGYDTERCFDCPHGDKVHPSYTVEGWTSTVIKDTK Predict reactive species
Full Name	ankyrin repeat and SOCS box-containing 14
Calculated Molecular Weight	587 aa, 65 kDa
Observed Molecular Weight	65 kDa
GenBank Accession Number	BC114953
Gene Symbol	ASB14
Gene ID (NCBI)	142686
RRID	AB_2880017
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	A6NK59
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.

Able™