ASC/TMS1 Monoclonal antibody, PBS Only

• 

  WB analysis using 67494-1-Ig (same clone as 67494-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67494-1-Ig (ASC/TMS1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated GAPDH Monoclonal antibody (HRP-60004) as loading control. This data was developed using the same antibody clone with 67494-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human placenta using 67494-1-Ig (same clone as 67494-1-PBS)

  human placenta tissue were subjected to SDS PAGE followed by western blot with 67494-1-Ig (ASC/TMS1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67494-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HL-60 using 67494-1-Ig (same clone as 67494-1-PBS)

  HL-60 cells were subjected to SDS PAGE followed by western blot with 67494-1-Ig (ASC/TMS1 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67494-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 67494-1-Ig (same clone as 67494-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 67494-1-Ig (ASC/TMS1 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67494-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 67494-1-Ig (same clone as 67494-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using ASC/TMS1 antibody (67494-1-Ig, Clone: 2G12E6 ) at dilution of 1:800 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L) (SA00013-1). This data was developed using the same antibody clone with 67494-1-PBS in a different storage buffer formulation.

• 

  IF Staining of MCF-7 using 67494-1-Ig (same clone as 67494-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed MCF-7 cells using ASC/TMS1 antibody (67494-1-Ig, Clone: 2G12E6 ) at dilution of 1:800 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L) (SA00013-1). This data was developed using the same antibody clone with 67494-1-PBS in a different storage buffer formulation.

• 

  IF Staining of THP-1 using 67494-1-Ig (same clone as 67494-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed THP-1 cells using ASC/TMS1 antibody (67494-1-Ig, Clone: 2G12E6 ) at dilution of 1:800 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L) (SA00013-1). This data was developed using the same antibody clone with 67494-1-PBS in a different storage buffer formulation.

ASC/TMS1 Monoclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 67494-1-PBS

Clone No.2G12E6

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

PYCARD, 2G12E6, Apoptosis-associated speck-like protein containing a CARD, ASC, CARD5

---

Product Information

67494-1-PBS targets ASC/TMS1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag28424

  Product name: Recombinant human TMS1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-135 aa of BC004470

  Sequence: MGRARDAILDALENLTAEELKKFKLQAATHQGSGAAPAGIQAPPQSAAKPGLHFIDQHRAALIARVTNVEWLLDALYGKVLTDEQYQAVRAEPTNPSKMRKLFSFTPAWNWTCKDLLLQALRESQSYLVEDLERS

• Full Name: PYD and CARD domain containing
• Calculated Molecular Weight: 25 kDa
• Observed Molecular Weight: 22-25 kDa
• GenBank Accession Number: BC004470
• Gene Symbol: ASC/TMS1
• Gene ID (NCBI): 29108
• RRID: AB_2882718
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q9ULZ3
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

PYCARD , also known as ASC or TMS1, is a 195 amino acid protein containing an N-terminal Pyrin-like domain (PYD) and an 87 residue C-terminal Caspase-associated recruitment domain (CARD). It promotes caspase-mediated apoptosis which is mediated predominantly through the activation of caspase-9.