CoraLite® Plus 488-conjugated ASL Monoclonal antibody

ASL Monoclonal Antibody for FC (Intra)
Cat No. CL488-67692
Clone No.1G9H3

Host / Isotype

Mouse / IgG2b

Reactivity

human, mouse, rat, pig

Applications

FC (Intra)

1G9H3, argininosuccinate lyase, Arginosuccinase, ASAL, EC:4.3.2.1

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive FC (Intra) detected inK-562 cells

Recommended dilution

ApplicationDilution
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-67692 targets ASL in FC (Intra) applications and shows reactivity with human, mouse, rat, pig samples.

Tested Reactivity human, mouse, rat, pig
Host / Isotype Mouse / IgG2b
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag30517

Product name: Recombinant human ASL protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 114-464 aa of BC008195

Sequence: NDQVVTDLRLWMRQTCSTLSGLLWELIRTMVDRAEAERDVLFPGYTHLQRAQPIRWSHWILSHAVALTRDSERLLEVRKRINVLPLGSGAIAGNPLGVDRELLRAELNFGAITLNSMDATSERDFVAEFLFWASLCMTHLSRMAEDLILYCTKEFSFVQLSDAYSTGSSLMPQKKNPDSLELIRSKAGRVFGRCAGLLMTLKGLPSTYNKDLQEDKEAVFEVSDTMSAVLQVATGVISTLQIHQENMGQALSPDMLATDLAYYLVRKGMPFRQAHEASGKAVFMAETKGVALNQLSLQELQTISPLFSGDVICVWDYGHSVEQYGALGGTARSSVDWQIRQVRALLQAQQA

Predict reactive species
Full Name argininosuccinate lyase
Calculated Molecular Weight 55 kDa
Observed Molecular Weight50 kDa
GenBank Accession NumberBC008195
Gene Symbol ASL
Gene ID (NCBI) 435
RRIDAB_2923781
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP04424
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Argininosuccinate lyase (ASL), one of the significant UC enzymes, catalyzes argininosuccinate cleavage to generate arginine and fumarate. Arginine is then catalyzed by arginase to ornithine and polyamines, which are found to promote cancer cell proliferation and growth. Importantly, ASL ectopic expression is closely associated with poor prognosis of colorectal cancer, hepatocellular. ASL is a member of the aspartase/fumarase superfamily. Enzymes of this superfamily share similar tetrameric structure and active site, though the sequence identities between different members are quite low (less than 20%). Members of this superfamily have been recognised as drug targets for microbial infections. ASL is a 464-amino-acid enzyme with a molecular mass of 49.7 kDa. (PMID: 22386318 PMID: 31018905)

Protocols

Product Specific Protocols
FC protocol for CL Plus 488 ASL antibody CL488-67692Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...