ATAD1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• ATAD1 Polyclonal antibody, PBS Only (16882-1-PBS)

• 

  WB analysis using 16882-1-AP (same clone as 16882-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 16882-1-AP (ATAD1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 16882-1-PBS in a different storage buffer formulation.

• 

  IP experiment of mouse brain using 16882-1-AP (same clone as 16882-1-PBS)

  IP result of anti-ATAD1 (IP:16882-1-AP, 4ug; Detection:16882-1-AP 1:1000) with mouse brain tissue lysate 1280 ug. This data was developed using the same antibody clone with 16882-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 16882-1-AP (same clone as 16882-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 16882-1-AP (ATAD1 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 16882-1-PBS in a different storage buffer formulation.

ATAD1 Polyclonal Antibody for WB, IHC, IP, Indirect ELISA

Cat No. 16882-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IP, Indirect ELISA

Synonyms

hATAD1, FNP001, EC:7.4.2.-, ATPase family AAA domain-containing protein 1, ATAD 1

---

Product Information

16882-1-PBS targets ATAD1 in WB, IHC, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag10343

  Product name: Recombinant human ATAD1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 164-361 aa of BC010868

  Sequence: DKWYGESQKLAAAVFSLAIKLQPSIIFIDEIDSFLRNRSSSDHEATAMMKAQFMSLWDGLDTDHSCQVIVMGATNRPQDLDSAIMRRMPTRFHINQPALKQREAILKLILKNENVDRHVDLLEVAQETDGFSGSDLKEMCRDAALLCVREYVNSTSEESHDEDEIRPVQQQDLHRAIEKMKKSKDAAFQNVLTHVCLD

• Full Name: ATPase family, AAA domain containing 1
• Calculated Molecular Weight: 361 aa, 41 kDa
• Observed Molecular Weight: 32 kDa
• GenBank Accession Number: BC010868
• Gene Symbol: ATAD1
• Gene ID (NCBI): 84896
• RRID: AB_2878327
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8NBU5
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

The mitochondrial AAA (ATPase Associated with diverse cellular Activities) protein ATAD1 (in humans; Msp1 in yeast) removes mislocalized membrane proteins, as well as stuck import substrates from the mitochondrial outer membrane, facilitating their re-insertion into their cognate organelles and maintaining mitochondria's protein import capacity.