ATG10 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• ATG10 Polyclonal antibody, PBS Only (13406-1-PBS)

• 

  WB analysis using 13406-1-AP (same clone as 13406-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 13406-1-AP (ATG10 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13406-1-PBS in a different storage buffer formulation.

ATG10 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 13406-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

EC:2.3.2.-, Autophagy-related protein 10, Autophagy related protein 10, APG10-like, APG10L

---

Product Information

13406-1-PBS targets ATG10 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4052

  Product name: Recombinant human ATG10 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-220 aa of BC029268

  Sequence: MEEDEFIGEKTFQRYCAEFIKHSQQIGDSWEWRPSKDCSDGYMCKIHFQIKNGSVMSHLGASTHGQTCLPMEEAFELPLDDCEVIETAAASEVIKYEYHVLYSCSYQVPVLYFRASFLDGRPLTLKDIWEGVHECYKMRLLQGPWDTITQQEHPILGQPFFVLHPCKTNEFMTPVLKNSQKINKNVNYITSWLSIVGPVVGLNLPLSYAKATSQDERNVP

• Full Name: ATG10 autophagy related 10 homolog (S. cerevisiae)
• Calculated Molecular Weight: 220 aa, 25 kDa
• Observed Molecular Weight: 25-30 kDa
• GenBank Accession Number: BC029268
• Gene Symbol: ATG10
• Gene ID (NCBI): 83734
• RRID: AB_3669161
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9H0Y0
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

ATG10, also named as APG10L, is an E2-like enzyme involved in autophagy. It catalyzes the conjugation reaction between Atg12 and Atg5. ATG10 plays a role in adenovirus-mediated cell lysis.