CoraLite®594-conjugated ATG16L1 Monoclonal antibody

ATG16L1 Monoclonal Antibody for IF/ICC
Cat No. CL594-67943
Clone No.1G5G7

Host / Isotype

Mouse / IgG1

Reactivity

Human, mouse, rat

Applications

IF/ICC

APG16 like 1, APG16L, ATG16L, ATG16L1, Autophagy related protein 16 1, FLJ00045, FLJ10035, FLJ10828, FLJ22677, IBD10, WDR30

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  CoraLite®594
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHepG2 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL594-67943 targets ATG16L1 in IF/ICC applications and shows reactivity with Human, mouse, rat samples.

Tested Reactivity Human, mouse, rat
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag14881

Product name: Recombinant human ATG16L1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 258-607 aa of BC000061

Sequence: RAISRAATKRLSQPAGGLLDSITNIFGRRSVSSFPVPQDNVDAHPGSGKEVRVPATALCVFDAHDGEVNAVQFSPGSRLLATGGMDRRVKLWEVFGEKCEFKGSLSGSNAGITSIEFDSAGSYLLAASNDFASRIWTVDDYRLRHTLTGHSGKVLSAKFLLDNARIVSGSHDRTLKLWDLRSKVCIKTVFAGSSCNDIVCTEQCVMSRHFDKKIRFWDIRSESIVREMELLGKITALDLNPERTELLSCSRDDLLKVIDLRTNAIKQTFSAPGFKCGSDWTRVVFSPDGSYVAAGSAEGSLYIWSVLTGKVEKVLSKQHSSSINAVAWSPSGSHVVSVDKGCKAVLWAQY

Predict reactive species
Full Name ATG16 autophagy related 16-like 1 (S. cerevisiae)
Calculated Molecular Weight 607 aa, 68 kDa
Observed Molecular Weight68-75 kDa
GenBank Accession NumberBC000061
Gene Symbol ATG16L1
Gene ID (NCBI) 55054
RRIDAB_2934788
Conjugate CoraLite®594 Fluorescent Dye
Excitation/Emission Maxima Wavelengths588 nm / 604 nm
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ676U5
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Human ATG16L1 is a 607 amino acid protein (~68 kDa) comprising three major domains: the N‐terminal ATG5 binding domain (ATG5‐BD), the central coiled‐coil domain (CCD) and a predicted C‐terminal WD40‐domain. ATG16L1α and β (Atg16L1α, 63 kDa; and Atg16L1β, 71 kDa) are the major isoforms expressed in intestinal epithelium and macrophages , and all isoforms encode exon 9, which contains Thr 300. Atg16L1 mediates the cellular degradative process of autophagy and is considered a critical regulator of inflammation based on its genetic association with inflammatory bowel disease. ATG16L1 has been implicated in Crohn's disease. (PMID: 24553140, PMID: 22740627,PMID: 28685931)

Protocols

Product Specific Protocols
IF protocol for CL594 ATG16L1 antibody CL594-67943Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...