CoraLite® Plus 488-conjugated ATM Recombinant monoclonal antibody

• 

  IF Staining of HepG2 using CL488-83608-5

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using CoraLite® Plus 488 ATM antibody (CL488-83608-5, Clone: 240560F5 ) at dilution of 1:200, CL594-phalloidin (red).

• Featured Product
• KD/KO Validated

ATM Uni-rAb^® Recombinant Antibody for IF/ICC

Cat No. CL488-83608-5

Clone No.240560F5

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IF/ICC

Synonyms

240560F5, A T mutated, A-T mutated, EC:2.7.11.1, Serine-protein kinase ATM

---

Tested Applications

• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-83608-5 targets ATM in IF/ICC applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag25920

  Product name: Recombinant human ATM protein

  Source: e coli.-derived, PET30a

  Tag: 6*His

  Domain: 1059-1361 aa of BC137169

  Sequence: SSEFENKQALLKRAKEEVGLLREHKIQTNRYTVKVQRELELDELALRALKEDRKRFLCKAVENYINCLLSGEEHDMWVFRLCSLWLENSGVSEVNGMMKRDGMKIPTYKFLPLMYQLAARMGTKMMGGLGFHEVLNNLISRISMDHPHHTLFIILALANANRDEFLTKPEVARRSRITKNVPKQSSQLDEDRTEAANRIICTIRSRRPQMVRSVEALCDAYIILANLDATQWKTQRKGINIPADQPITKLKNLEDVVVPTMEIKVDHTGEYGNLVTIQSFKAEFRLAGGVNLPKIIDCVGSDG

• Full Name: ataxia telangiectasia mutated
• Observed Molecular Weight: 310-350 kDa
• GenBank Accession Number: BC137169
• Gene Symbol: ATM
• Gene ID (NCBI): 472
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q13315
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

The ATM protein is a member of the phosphatidylinositol 3-kinase family of proteins that respond to DNA damage by phosphorylating key substrates involved in DNA repair and/or cell cycle control. It is involved in mitogenic signal transduction, meiotic recombination, detection of DNA damage, and cell cycle control.