ATP2A1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• ATP2A1 Polyclonal antibody, PBS Only (22361-1-PBS)

• 

  WB analysis using 22361-1-AP (same clone as 22361-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 22361-1-AP (ATP2A1 antibody) at dilution of 1:120000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 22361-1-PBS in a different storage buffer formulation.

• 

  IP experiment of mouse skeletal muscle using 22361-1-AP (same clone as 22361-1-PBS)

  IP result of anti-ATP2A1 (IP:22361-1-AP, 5ug; Detection:22361-1-AP 1:700) with mouse skeletal muscle tissue lysate 2160ug. This data was developed using the same antibody clone with 22361-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human skeletal muscle using 22361-1-AP (same clone as 22361-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human skeletal muscle tissue slide using 22361-1-AP (ATP2A1 Antibody) at dilution of 1:200 (under 10x lens). This data was developed using the same antibody clone with 22361-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human skeletal muscle using 22361-1-AP (same clone as 22361-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human skeletal muscle tissue slide using 22361-1-AP (ATP2A1 Antibody) at dilution of 1:200 (under 40x lens). This data was developed using the same antibody clone with 22361-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse skeletal muscle using 22361-1-AP (same clone as 22361-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse skeletal muscle tissue slide using 22361-1-AP (ATP2A1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 22361-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse skeletal muscle using 22361-1-AP (same clone as 22361-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse skeletal muscle tissue slide using 22361-1-AP (ATP2A1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 22361-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human heart using 22361-1-AP (same clone as 22361-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human heart tissue slide using 22361-1-AP (ATP2A1 Antibody) at dilution of 1:200 (under 10x lens). This data was developed using the same antibody clone with 22361-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human heart using 22361-1-AP (same clone as 22361-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human heart tissue slide using 22361-1-AP (ATP2A1 Antibody) at dilution of 1:200 (under 40x lens). This data was developed using the same antibody clone with 22361-1-PBS in a different storage buffer formulation.

ATP2A1 Polyclonal Antibody for WB, IHC, IP, Indirect ELISA

Cat No. 22361-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IP, Indirect ELISA

Synonyms

---

Product Information

22361-1-PBS targets ATP2A1 in WB, IHC, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag17944

  Product name: Recombinant human ATP2A1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 561-635 aa of BC037354

  Sequence: RCNYVRVGTTRVPLTGPVKEKIMAVIKEWGTGRDTLRCLALATRDTPPKREEMVLDDSARFLEYETDLTFVGVVG

• Full Name: ATPase, Ca++ transporting, cardiac muscle, fast twitch 1
• Calculated Molecular Weight: 1001 aa, 110 kDa
• Observed Molecular Weight: 116 kDa
• GenBank Accession Number: BC037354
• Gene Symbol: ATP2A1
• Gene ID (NCBI): 487
• RRID: AB_2879089
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen Affinity purified
• UNIPROT ID: O14983
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

ATP2A1 also known as SERCA1, encodes one of the SERCA Ca(2+)-ATPases, which are intracellular pumps located in the sarcoplasmic or endoplasmic reticula of muscle cells. This enzyme catalyzes the hydrolysis of ATP coupled with the translocation of calcium from the cytosol to the sarcoplasmic reticulum lumen and is involved in muscular excitation and contraction. Mutations in ATP2A1 cause some autosomal recessive forms of Brody disease(PMID: 23911890, 10914677).