CoraLite® Plus 488-conjugated ATP2A1 Recombinant monoclonal antibody

• 

  IF Staining of mouse skeletal muscle using CL488-84213-5

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse skeletal muscle tissue using CoraLite® Plus 488 ATP2A1 antibody (CL488-84213-5, Clone: 241500D12 ) at dilution of 1:200. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of mouse skeletal muscle using CL488-84213-5

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse skeletal muscle tissue using CoraLite® Plus 488 ATP2A1 antibody (CL488-84213-5, Clone: 241500D12 ) at dilution of 1:200. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

ATP2A1 Uni-rAb^® Recombinant Antibody for IF-P

Cat No. CL488-84213-5

Clone No.241500D12

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IF-P

Synonyms

241500D12, ATP2A, ATP2A 1, Calcium-transporting ATPase sarcoplasmic reticulum type, fast twitch skeletal muscle isoform, EC:7.2.2.10

---

Tested Applications

• Positive IF-P detected in: mouse skeletal muscle tissue

Recommended dilution

• Immunofluorescence (IF)-P: IF-P : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-84213-5 targets ATP2A1 in IF-P applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag17944

  Product name: Recombinant human ATP2A1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 561-635 aa of BC037354

  Sequence: RCNYVRVGTTRVPLTGPVKEKIMAVIKEWGTGRDTLRCLALATRDTPPKREEMVLDDSARFLEYETDLTFVGVVG

• Full Name: ATPase, Ca++ transporting, cardiac muscle, fast twitch 1
• Calculated Molecular Weight: 1001 aa, 110 kDa
• Observed Molecular Weight: 110 kDa
• GenBank Accession Number: BC037354
• Gene Symbol: ATP2A1
• Gene ID (NCBI): 487
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: O14983
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

ATP2A1 also known as SERCA1, encodes one of the SERCA Ca(2+)-ATPases, which are intracellular pumps located in the sarcoplasmic or endoplasmic reticula of muscle cells. This enzyme catalyzes the hydrolysis of ATP coupled with the translocation of calcium from the cytosol to the sarcoplasmic reticulum lumen and is involved in muscular excitation and contraction. Mutations in ATP2A1 cause some autosomal recessive forms of Brody disease(PMID: 23911890, 10914677).