CoraLite® Plus 488-conjugated ATP2A1 Recombinant monoclonal antibody

ATP2A1 Uni-rAb® Recombinant Antibody for IF-P
Cat No. CL488-84213-5
Clone No.241500D12

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IF-P

241500D12, ATP2A, ATP2A 1, Calcium-transporting ATPase sarcoplasmic reticulum type, fast twitch skeletal muscle isoform, EC:7.2.2.10

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF-P detected inmouse skeletal muscle tissue

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)-PIF-P : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-84213-5 targets ATP2A1 in IF-P applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag17944

Product name: Recombinant human ATP2A1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 561-635 aa of BC037354

Sequence: RCNYVRVGTTRVPLTGPVKEKIMAVIKEWGTGRDTLRCLALATRDTPPKREEMVLDDSARFLEYETDLTFVGVVG

Predict reactive species
Full Name ATPase, Ca++ transporting, cardiac muscle, fast twitch 1
Calculated Molecular Weight 1001 aa, 110 kDa
Observed Molecular Weight 110 kDa
GenBank Accession NumberBC037354
Gene Symbol ATP2A1
Gene ID (NCBI) 487
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
Excitation LaserBlue laser (488 nm)
FormLiquid
Purification MethodProtein A purification
UNIPROT IDO14983
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

ATP2A1 also known as SERCA1, encodes one of the SERCA Ca(2+)-ATPases, which are intracellular pumps located in the sarcoplasmic or endoplasmic reticula of muscle cells. This enzyme catalyzes the hydrolysis of ATP coupled with the translocation of calcium from the cytosol to the sarcoplasmic reticulum lumen and is involved in muscular excitation and contraction. Mutations in ATP2A1 cause some autosomal recessive forms of Brody disease(PMID: 23911890, 10914677).

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 ATP2A1 antibody CL488-84213-5Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...