ATP5F1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• ATP5F1 Polyclonal antibody, PBS Only (15999-1-PBS)

• 

  WB analysis using 15999-1-AP (same clone as 15999-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 15999-1-AP (ATP5F1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15999-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 15999-1-AP (same clone as 15999-1-PBS)

  WB result of ATP5F1 antibody (15999-1-AP; 1:4000; incubated at room temperature for 1.5 hours) with sh-Control and sh-ATP5F1 transfected HeLa cells. This data was developed using the same antibody clone with 15999-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse skeletal muscle using 15999-1-AP (same clone as 15999-1-PBS)

  mouse skeletal muscle tissue were subjected to SDS PAGE followed by western blot with 15999-1-AP (ATP5F1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15999-1-PBS in a different storage buffer formulation.

• 

  IP experiment of HEK-293T using 15999-1-AP (same clone as 15999-1-PBS)

  IP result of anti-ATP5F1 (IP:15999-1-AP, 4ug; Detection:15999-1-AP 1:2000) with HEK-293T cells lysate 1600 ug. This data was developed using the same antibody clone with 15999-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver using 15999-1-AP (same clone as 15999-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 15999-1-AP (ATP5F1 Antibody) at dilution of 1:200 (under 10x lens). This data was developed using the same antibody clone with 15999-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver using 15999-1-AP (same clone as 15999-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 15999-1-AP (ATP5F1 Antibody) at dilution of 1:200 (under 40x lens). This data was developed using the same antibody clone with 15999-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human kidney using 15999-1-AP (same clone as 15999-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human kidney using 15999-1-AP (ATP5F1 antibody) at dilution of 1:100 (under 40x lens). This data was developed using the same antibody clone with 15999-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human testis using 15999-1-AP (same clone as 15999-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human testis using 15999-1-AP (ATP5F1 antibody) at dilution of 1:100 (under 10x lens). This data was developed using the same antibody clone with 15999-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human testis using 15999-1-AP (same clone as 15999-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human testis using 15999-1-AP (ATP5F1 antibody) at dilution of 1:100 (under 40x lens). This data was developed using the same antibody clone with 15999-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human skin using 15999-1-AP (same clone as 15999-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human skin using 15999-1-AP (ATP5F1 antibody) at dilution of 1:100 (under 10x lens). This data was developed using the same antibody clone with 15999-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human skin using 15999-1-AP (same clone as 15999-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human skin using 15999-1-AP (ATP5F1 antibody) at dilution of 1:100 (under 40x lens). This data was developed using the same antibody clone with 15999-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human brain using 15999-1-AP (same clone as 15999-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human brain using 15999-1-AP (ATP5F1 antibody) at dilution of 1:100 (under 10x lens). This data was developed using the same antibody clone with 15999-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human heart using 15999-1-AP (same clone as 15999-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human heart using 15999-1-AP (ATP5F1 antibody) at dilution of 1:100 (under 10x lens). This data was developed using the same antibody clone with 15999-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human heart using 15999-1-AP (same clone as 15999-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human heart using 15999-1-AP (ATP5F1 antibody) at dilution of 1:100 (under 40x lens). This data was developed using the same antibody clone with 15999-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human brain using 15999-1-AP (same clone as 15999-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human brain using 15999-1-AP (ATP5F1 antibody) at dilution of 1:100 (under 40x lens). This data was developed using the same antibody clone with 15999-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human kidney using 15999-1-AP (same clone as 15999-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human kidney using 15999-1-AP (ATP5F1 antibody) at dilution of 1:100 (under 10x lens). This data was developed using the same antibody clone with 15999-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver using 15999-1-AP (same clone as 15999-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver using 15999-1-AP (ATP5F1 antibody) at dilution of 1:100 (under 10x lens). This data was developed using the same antibody clone with 15999-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver using 15999-1-AP (same clone as 15999-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver using 15999-1-AP (ATP5F1 antibody) at dilution of 1:100 (under 40x lens). This data was developed using the same antibody clone with 15999-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 15999-1-AP (same clone as 15999-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using ATP5F1 antibody (15999-1-AP) at dilution of 1:200 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002). This data was developed using the same antibody clone with 15999-1-PBS in a different storage buffer formulation.

• 

  FC experiment of HeLa using 15999-1-AP (same clone as 15999-1-PBS)

  1X10^6 HeLa cells were intracellularly stained with 0.4 ug Anti-Human ATP5F1 (15999-1-AP) and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) at dilution 1:1000 (red), or 0.4 ug Isotype Control. Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer. This data was developed using the same antibody clone with 15999-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

ATP5F1 Polyclonal Antibody for WB, IHC, IF/ICC, FC (Intra), IP, Indirect ELISA

Cat No. 15999-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, FC (Intra), IP, Indirect ELISA

Synonyms

ATP synthase F(0) complex subunit B1, mitochondrial, ATP synthase peripheral stalk-membrane subunit b, ATP synthase proton-transporting mitochondrial F(0) complex subunit B1, ATP synthase subunit b, ATP5F 1

---

Product Information

15999-1-PBS targets ATP5F1 in WB, IHC, IF/ICC, FC (Intra), IP, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag8571

  Product name: Recombinant human ATP5F1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-256 aa of BC005366

  Sequence: MLSRVVLSAAATAAPSLKNAAFLGPGVLQATRTFHTGQPHLVPVPPLPEYGGKVRYGLIPEEFFQFLYPKTGVTGPYVLGTGLILYALSKEIYVISAETFTALSVLGVMVYGIKKYGPFVADFADKLNEQKLAQLEEAKQASIQHIQNAIDTEKSQQALVQKRHYLFDVQRNNIAMALEVTYRERLYRVYKEVKNRLDYHISVQNMMRRKEQEHMINWVEKHVVQSISTQQEKETIAKCIADLKLLAKKAQAQPVM

• Full Name: ATP synthase, H+ transporting, mitochondrial F0 complex, subunit B1
• Calculated Molecular Weight: 256 aa, 29 kDa
• Observed Molecular Weight: 25-30 kDa
• GenBank Accession Number: BC005366
• Gene Symbol: ATP5F1
• Gene ID (NCBI): 515
• RRID: AB_2258817
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P24539
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

ATP5F1(ATP synthase subunit b) belongs to the eukaryotic ATPase B chain family. The ATP5F1 gene encodes subunit B of the mitochondrial ATP synthase Fo unit, which contains 214-amino acid with a 42-amino acid import signal(PMID:1831354). Mitochondrial membrane ATP synthase(F1F0 ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain.