CoraLite® Plus 488-conjugated ATPBD3 Recombinant monoclonal antibody

• 

  IF Staining of mouse kidney using CL488-84318-4

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse kidney tissue using CoraLite® Plus 488 ATPBD3 antibody (CL488-84318-4, Clone: 241630C4 ) at dilution of 1:200. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

ATPBD3 Uni-rAb^® Recombinant Antibody for IF-P

Cat No. CL488-84318-4

Clone No.241630C4

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IF-P

Synonyms

CTU1, NCS6

---

Tested Applications

• Positive IF-P detected in: mouse kidney tissue

Recommended dilution

• Immunofluorescence (IF)-P: IF-P : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-84318-4 targets ATPBD3 in IF-P applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag35037

  Product name: Recombinant human ATPBD3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 50-200 aa of NM_145232

  Sequence: PGAVVAVGASGGKDSTVLAHVLRALAPRLGISLQLVAVDEGIGGYRDAALAAVRRQAARWELPLTVVAYEDLFGGWTMDAVARSTAGSGRSRSCCTFCGVLRRRALEEGARRVGATHIVTGHNADDMAETVLMNFLRGDAGRLARGGGLGS

• Full Name: ATP binding domain 3
• Calculated Molecular Weight: 36 kDa
• Observed Molecular Weight: 35 kDa
• GenBank Accession Number: NM_145232
• Gene Symbol: ATPBD3
• Gene ID (NCBI): 90353
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q7Z7A3
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

ATPBD3, also known as CTU1, NCS6, is a subunit of a highly conserved protein complex involved in the thiolation of wobble U34(PMID: 18391219). ATPBD3 directly binds tRNAs and probably acts by catalyzing the adenylation of tRNAs, an intermediate required for 2-thiolation.