AZI2 Monoclonal antibody, PBS Only

• 

  WB analysis using 68326-1-Ig (same clone as 68326-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 68326-1-Ig (AZI2 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated GAPDH Monoclonal antibody (HRP-60004) as loading control. This data was developed using the same antibody clone with 68326-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 68326-1-Ig (same clone as 68326-1-PBS)

  Immunofluorescent analysis of (-20°C Methanol) fixed HeLa cells using AZI2 antibody (68326-1-Ig, Clone: 2F1G5 ) at dilution of 1:1000 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 68326-1-PBS in a different storage buffer formulation.

AZI2 Monoclonal Antibody for WB, IF/ICC, ELISA

Cat No. 68326-1-PBS

Clone No.2F1G5

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, ELISA

Synonyms

AZI2/NAP1, 2F1G5, 5 azacytidine induced 2, 5-azacytidine-induced protein 2, Nak associated protein 1

---

Product Information

68326-1-PBS targets AZI2 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag6755

  Product name: Recombinant human AZI2 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-264 aa of BC001139

  Sequence: MDALVEDDICILNHEKAHKRDTVTPVSIYSGDESVASHFALVTAYEDIKKRLKDSEKENSLLKKRIRFLEEKLIARFEEETSSVGREQVNKAYHAYREVCIDRDNLKSKLDKMNKDNSESLKVLNEQLQSKEVELLQLRTEVETQQVMRNLNPPSSNWEVEKLSCDLKIHGLEQELELMRKECSDLKIELQKAKQTDPYQEDNLKSRDLQKLSISSDNMQHAYWELKREMSNLHLVTQVQAELLRKLKTSTAIKKGKSLFTGNH

• Full Name: 5-azacytidine induced 2
• Calculated Molecular Weight: 45 kDa
• Observed Molecular Weight: 45 kDa
• GenBank Accession Number: BC001139
• Gene Symbol: AZI2
• Gene ID (NCBI): 64343
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q9H6S1
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

AZI2, also known as NAP1, is a TNF receptor (TNFR)-associated factor family member-associated NF-κB activator-binding kinase 1-binding protein that regulates the production of IFNs. It is an adapter protein which binds TBK1 and IKBKE playing a role in antiviral innate immunity. NAP1 is a kind of adapter protein which binds TBK1 and IKBKE playing a role in antiviral innate immunity. (PMID: 21931631)