AZI2 Monoclonal antibody

AZI2 Monoclonal Antibody for WB, IF/ICC, ELISA
Cat No. 68326-1-Ig
Clone No.2F1G5

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, ELISA

AZI2/NAP1, 2F1G5, 5 azacytidine induced 2, 5-azacytidine-induced protein 2, Nak associated protein 1

Formulation:  PBS and Azide
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inU2OS cells, MDA-MB-231 cells, SK-BR-3 cells, LNCaP cells, HeLa cells, HEK-293 cells, K-562 cells, HSC-T6 cells, 4T1 cells
Positive IF/ICC detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunofluorescence (IF)/ICCIF/ICC : 1:500-1:2000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

68326-1-Ig targets AZI2 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag6755

Product name: Recombinant human AZI2 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-264 aa of BC001139

Sequence: MDALVEDDICILNHEKAHKRDTVTPVSIYSGDESVASHFALVTAYEDIKKRLKDSEKENSLLKKRIRFLEEKLIARFEEETSSVGREQVNKAYHAYREVCIDRDNLKSKLDKMNKDNSESLKVLNEQLQSKEVELLQLRTEVETQQVMRNLNPPSSNWEVEKLSCDLKIHGLEQELELMRKECSDLKIELQKAKQTDPYQEDNLKSRDLQKLSISSDNMQHAYWELKREMSNLHLVTQVQAELLRKLKTSTAIKKGKSLFTGNH

Predict reactive species
Full Name 5-azacytidine induced 2
Calculated Molecular Weight 45 kDa
Observed Molecular Weight 45 kDa
GenBank Accession NumberBC001139
Gene Symbol AZI2
Gene ID (NCBI) 64343
RRIDAB_2935398
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ9H6S1
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

AZI2, also known as NAP1, is a TNF receptor (TNFR)-associated factor family member-associated NF-κB activator-binding kinase 1-binding protein that regulates the production of IFNs. It is an adapter protein which binds TBK1 and IKBKE playing a role in antiviral innate immunity. NAP1 is a kind of adapter protein which binds TBK1 and IKBKE playing a role in antiviral innate immunity. (PMID: 21931631)

Protocols

Product Specific Protocols
WB protocol for AZI2 antibody 68326-1-IgDownload protocol
IF protocol for AZI2 antibody 68326-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Muhammed Talha (Verified Customer) (08-31-2023)

I tested this antibody in WT vs NAP1 KO cells. It gave me 2 bands. One of them is actual band and other one is nonspecific one I guess. They are very close to each other and hard to separate them unfortunately.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:10000
  • Cell Tissue Type: hela
AZI2 Antibody Western Blot validation (1:10000 dilution) in hela (Cat no:68326-1-Ig)
Loading...
||
New chat Able
正在加载,请稍候...