Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

AZI2 Monoclonal antibody

AZI2 Monoclonal Antibody for WB, IF/ICC, ELISA

Cat No. 68326-1-Ig
Clone No.2F1G5

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, ELISA

AZI2/NAP1, 2F1G5, 5 azacytidine induced 2, 5-azacytidine-induced protein 2, Nak associated protein 1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 488
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inU2OS cells, HeLa cells, MDA-MB-231 cells, SK-BR-3 cells, LNCaP cells, HEK-293 cells, K-562 cells, HSC-T6 cells, 4T1 cells
Positive IF/ICC detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunofluorescence (IF)/ICCIF/ICC : 1:500-1:2000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

68326-1-Ig targets AZI2 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag6755

Product name: Recombinant human AZI2 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-264 aa of BC001139

Sequence: MDALVEDDICILNHEKAHKRDTVTPVSIYSGDESVASHFALVTAYEDIKKRLKDSEKENSLLKKRIRFLEEKLIARFEEETSSVGREQVNKAYHAYREVCIDRDNLKSKLDKMNKDNSESLKVLNEQLQSKEVELLQLRTEVETQQVMRNLNPPSSNWEVEKLSCDLKIHGLEQELELMRKECSDLKIELQKAKQTDPYQEDNLKSRDLQKLSISSDNMQHAYWELKREMSNLHLVTQVQAELLRKLKTSTAIKKGKSLFTGNH

Predict reactive species
Full Name 5-azacytidine induced 2
Calculated Molecular Weight 45 kDa
Observed Molecular Weight 45 kDa
GenBank Accession NumberBC001139
Gene Symbol AZI2
Gene ID (NCBI) 64343
RRIDAB_2935398
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ9H6S1
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

AZI2, also known as NAP1, is a TNF receptor (TNFR)-associated factor family member-associated NF-κB activator-binding kinase 1-binding protein that regulates the production of IFNs. It is an adapter protein which binds TBK1 and IKBKE playing a role in antiviral innate immunity. NAP1 is a kind of adapter protein which binds TBK1 and IKBKE playing a role in antiviral innate immunity. (PMID: 21931631)

Protocols

Product Specific Protocols
IF protocol for AZI2 antibody 68326-1-IgDownload protocol
WB protocol for AZI2 antibody 68326-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Reviews

    5.0 out of 5
Add a review

1 verified customer reviews

What customers say

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


Muhammed Talha (Verified Customer) (08-31-2023)

I tested this antibody in WT vs NAP1 KO cells. It gave me 2 bands. One of them is actual band and other one is nonspecific one I guess. They are very close to each other and hard to separate them unfortunately.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:10000
  • Cell Tissue Type: hela
AZI2 Antibody Western Blot validation (1:10000 dilution) in hela (Cat no:68326-1-Ig)
Loading...
||
New chat

Able

正在加载,请稍候...