Alpha B Crystallin Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Alpha B Crystallin Polyclonal antibody, PBS Only (15808-1-PBS)

• 

  WB analysis using 15808-1-AP (same clone as 15808-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 15808-1-AP (Alpha B Crystallin antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15808-1-PBS in a different storage buffer formulation.

• 

  WB analysis of U2OS using 15808-1-AP (same clone as 15808-1-PBS)

  WB result of Alpha B Crystallin antibody (15808-1-AP; 1:2000; incubated at room temperature for 1.5 hours) with sh-Control and sh-Alpha B Crystallin transfected U2OS cells. This data was developed using the same antibody clone with 15808-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 15808-1-AP (same clone as 15808-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 15808-1-AP (Alpha B Crystallin antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15808-1-PBS in a different storage buffer formulation.

• 

  IP experiment of U2OS using 15808-1-AP (same clone as 15808-1-PBS)

  IP result of anti-Alpha B Crystallin (IP:15808-1-AP, 4ug; Detection:15808-1-AP 1:500) with U2OS cells lysate 1800 ug. This data was developed using the same antibody clone with 15808-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse heart using 15808-1-AP (same clone as 15808-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse heart tissue slide using 15808-1-AP (Alpha B Crystallin antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 15808-1-PBS in a different storage buffer formulation.

• 

  IF Staining of U2OS using 15808-1-AP (same clone as 15808-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed U2OS cells using Alpha B Crystallin antibody (15808-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 15808-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

Alpha B Crystallin Polyclonal Antibody for WB, IHC, IF/ICC, IP, Indirect ELISA

Cat No. 15808-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, Indirect ELISA

Synonyms

CRYAB, Alpha crystallin B chain, Alpha(B) crystallin, Alpha(B)-crystallin, Alpha-crystallin B chain

---

Product Information

15808-1-PBS targets Alpha B Crystallin in WB, IHC, IF/ICC, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag8543

  Product name: Recombinant human aB-Crystallin protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-175 aa of BC007008

  Sequence: MDIAIHHPWIRRPFFPFHSPSRLFDQFFGEHLLESDLFPTSTSLSPFYLRPPSFLRAPSWFDTGLSEMRLEKDRFSVNLDVKHFSPEELKVKVLGDVIEVHGKHEERQDEHGFISREFHRKYRIPADVDPLTITSSLSSDGVLTVNGPRKQVSGPERTIPITREEKPAVTAAPKK

• Full Name: crystallin, alpha B
• Calculated Molecular Weight: 175 aa, 20 kDa
• Observed Molecular Weight: 20-22 kDa
• GenBank Accession Number: BC007008
• Gene Symbol: Alpha B Crystallin
• Gene ID (NCBI): 1410
• RRID: AB_2292175
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P02511
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Alpha B-crystallin, encoded by CRYAB gene, is multifunctional, serving as both a major structural protein in the lens and a small heat-shock protein in other tissues in mammals. Alpha B-crystallin may contribute to the transparency and refractive index of the lens. Single nucleotide polymorphisms (SNPs) in the promoter region of CRYAB gene have been associated with in multiple sclerosis. Mutations in the CRYAB gene cause distinct clinical phenotypes including isolated posterior polar cataract, myofibrillar myopathy, cardiomyopathy, or a multisystemic disorder combining all these features. Impairment of alpha-B crystallin dimerization may be relevant to the pathogenesis of these disorders.