CoraLite® Plus 750-conjugated Alpha Synuclein Polyclonal antibody

• Home
• Products
• Primary Antibodies
• CoraLite® Plus 750-conjugated Alpha Synuclein Polyclonal antibody (CL750-10842)

• Featured Product
• KD/KO Validated

Alpha Synuclein Polyclonal Antibody for IF-P

Cat No. CL750-10842

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IF-P

Synonyms

1, a-synuclein, SNCA, alpha syn, alpha-syn

• 

  IF Staining of mouse brain using CL750-10842

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse brain tissue using CoraLite® Plus 750 Alpha Synuclein antibody (CL750-10842) at dilution of 1:200. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive IF-P detected in: mouse brain tissue

Recommended dilution

• Immunofluorescence (IF)-P: IF-P : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL750-10842 targets Alpha Synuclein in IF-P applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1285

  Product name: Recombinant human a-Synuclein protein

  Source: e coli.-derived, PKG

  Tag: GST

  Domain: 1-140 aa of BC013293

  Sequence: MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA

• Full Name: synuclein, alpha (non A4 component of amyloid precursor)
• Calculated Molecular Weight: 14 kDa
• Observed Molecular Weight: 15-19 kDa
• GenBank Accession Number: BC013293
• Gene Symbol: Alpha Synuclein
• Gene ID (NCBI): 6622
• Conjugate: CoraLite® Plus 750 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 755 nm / 780 nm
• Excitation Laser: Red Laser (633 nm)
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P37840
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

Alpha Synuclein (α-syn) is a 14-19 kDa phosphoprotein that is primarily localize to the presynaptic terminals of mature neurons, where it is involved in synaptic function and plasticity. Α-syn has drawn intense interest ever since the late 1990s, when the first α-synuclein missense mutation was identified as a cause of familial Parkinson's disease (PD). Aggregated and hyper-phosphorylated forms of α-syn protein are the pathological hallmark of Lewy body disease, which includes Parkinson's disease (PD), diffuse Lewy body disease (DLBD), and Lewy body variant of Alzheimer's disease (LBV). This antibody can recognize all the isoforms of α-syn.