CoraLite®594-conjugated Apolipoprotein A II/APOA2 Monoclonal antibody

Apolipoprotein A II/APOA2 Monoclonal Antibody for FC (Intra)
Cat No. CL594-66773
Clone No.1G1A2

Host / Isotype

Mouse / IgG2b

Reactivity

human

Applications

FC (Intra)

APOA2, apolipoprotein A II, ApoA-II, Apo-AII, ApoA II

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  CoraLite®594
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive FC (Intra) detected inHepG2 cells

Recommended dilution

ApplicationDilution
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL594-66773 targets Apolipoprotein A II/APOA2 in FC (Intra) applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Mouse / IgG2b
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag9863

Product name: Recombinant human APOA2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-100 aa of BC005282

Sequence: MKLLAATVLLLTICSLEGALVRRQAKEPCVESLVSQYFQTVTDYGKDLMEKVKSPELQAEAKSYFEKSKEQLTPLIKKAGTELVNFLSYFVELGTQPATQ

Predict reactive species
Full Name apolipoprotein A-II
Calculated Molecular Weight 100 aa, 11 kDa
Observed Molecular Weight 8-11 kDa
GenBank Accession NumberBC005282
Gene Symbol APOA2
Gene ID (NCBI) 336
RRIDAB_3084725
Conjugate CoraLite®594 Fluorescent Dye
Excitation/Emission Maxima Wavelengths588 nm / 604 nm
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP02652
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Apolipoprotein A-II (APOA2) is a major component of high density lipoprotein (HDL) and it plays an important role in directing the fate of lipid metabolism among HDL. It is primarily synthesized by liver. The predicted MW of ApoA2 is 11 kDa, while the mature form is smaller (7-10 kDa) since the signal peptide was cleaved. In humans, most of circulating apoA2 exist as dimer. Five types of APOA2 dimer exist: homodimer apoA2-ATQ/ATQ, heterodimer apoA2-ATQ/AT, homodimer apoA2-AT/AT, apoA2-AT/A, and apoA2-A/A. ApoA2 isoforms are considered to be some of the most promising serum/plasma biomarkers for aiding the early detection of pancreatic cancer. (PMID: 29081441, 29481802)

Protocols

Product Specific Protocols
FC protocol for CL594 Apolipoprotein A II/APOA2 antibody CL594-66773Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...