B4GALNT1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• B4GALNT1 Polyclonal antibody, PBS Only (13396-1-PBS)

• 

  WB analysis of COLO 320 using 13396-1-AP (same clone as 13396-1-PBS)

  COLO 320 cells were subjected to SDS PAGE followed by western blot with 13396-1-AP (B4GALNT1 antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13396-1-PBS in a different storage buffer formulation.

• 

  WB analysis of A375 using 13396-1-AP (same clone as 13396-1-PBS)

  A375 cells were subjected to SDS PAGE followed by western blot with 13396-1-AP (B4GALNT1 antibody) at dilution of 1:0 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13396-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

B4GALNT1 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 13396-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

---

Product Information

13396-1-PBS targets B4GALNT1 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4065

  Product name: Recombinant human B4GALNT1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 29-328 aa of BC029828

  Sequence: DAPGLRLPLAPWAPPQSPRRPELPDLAPEPRYAHIPVRIKEQVVGLLAWNNCSCESSGGGLPLPFQKQVRAIDLTKAFDPAELRAASATREQEFQAFLSRSQSPADQLLIAPANSPLQYPLQGVEVQPLRSILVPGLSLQAASGQEVYQVNLTASLGTWDVAGEVTGVTLTGEGQADLTLVSPGLDQLNRQLQLVTYSSRSYQTNTADTGARPGWRDGQAGQTEKNQKGWSGQMAEGMGGIWAMARAVQPHNGCFNWTSRARGRKGAFVHLGLEQARGKPEPWVCLPFRPTVGGPRKRLV

• Full Name: beta-1,4-N-acetyl-galactosaminyl transferase 1
• Calculated Molecular Weight: 532 aa, 58 kDa
• Observed Molecular Weight: 67.5 kDa
• GenBank Accession Number: BC029828
• Gene Symbol: B4GALNT1
• Gene ID (NCBI): 2583
• RRID: AB_2061077
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q00973
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.