B4GALT2 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• B4GALT2 Polyclonal antibody, PBS Only (20330-1-PBS)

• 

  WB analysis of PC-3 using 20330-1-AP (same clone as 20330-1-PBS)

  PC-3 cells were subjected to SDS PAGE followed by western blot with 20330-1-AP (B4GALT2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 20330-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse large intestine using 20330-1-AP (same clone as 20330-1-PBS)

  mouse large intestine tissue were subjected to SDS PAGE followed by western blot with 20330-1-AP (B4GALT2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 20330-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse brain using 20330-1-AP (same clone as 20330-1-PBS)

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 20330-1-AP (B4GALT2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 20330-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse ovary using 20330-1-AP (same clone as 20330-1-PBS)

  mouse ovary tissue were subjected to SDS PAGE followed by western blot with 20330-1-AP (B4GALT2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 20330-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse skeletal muscle using 20330-1-AP (same clone as 20330-1-PBS)

  mouse skeletal muscle tissue were subjected to SDS PAGE followed by western blot with 20330-1-AP (B4GALT2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 20330-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 20330-1-AP (same clone as 20330-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer using 20330-1-AP (B4GALT2 antibody) at dilution of 1:100 (under 10x lens). This data was developed using the same antibody clone with 20330-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 20330-1-AP (same clone as 20330-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer using 20330-1-AP (B4GALT2 antibody) at dilution of 1:100 (under 40x lens). This data was developed using the same antibody clone with 20330-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 20330-1-AP (same clone as 20330-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer using 20330-1-AP (B4GALT2 antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 20330-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 20330-1-AP (same clone as 20330-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer using 20330-1-AP (B4GALT2 antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 20330-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human ovary using 20330-1-AP (same clone as 20330-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human ovary using 20330-1-AP (B4GALT2 antibody) at dilution of 1:100 (under 10x lens). This data was developed using the same antibody clone with 20330-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human ovary using 20330-1-AP (same clone as 20330-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human ovary using 20330-1-AP (B4GALT2 antibody) at dilution of 1:100 (under 40x lens). This data was developed using the same antibody clone with 20330-1-PBS in a different storage buffer formulation.

B4GALT2 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 20330-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

B4Gal T2, b4Gal-T2, Beta 1,4 GalTase 2, Beta-1,4-galactosyltransferase 2, Beta-1,4-GalTase 2

---

Product Information

20330-1-PBS targets B4GALT2 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag14046

  Product name: Recombinant human B4GALT2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 60-176 aa of BC002431

  Sequence: PGVLMGGRYTPPDCTPAQTVAVIIPFRHREHHLRYWLHYLHPILRRQRLRYGVYVINQHGEDTFNRAKLLNVGFLEALKEDAAYDCFIFSDVDLVPMDDRNLYRCGDQPRHFAIAMD

• Full Name: UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 2
• Calculated Molecular Weight: 372 aa, 42 kDa
• Observed Molecular Weight: 42-45 kDa
• GenBank Accession Number: BC002431
• Gene Symbol: B4GALT2
• Gene ID (NCBI): 8704
• RRID: AB_10693615
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O60909
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.