B4GALT6 Recombinant monoclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• B4GALT6 Recombinant monoclonal antibody, PBS Only (87222-2-PBS)

B4GALT6 Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 87222-2-PBS

Clone No.251395A11

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

b4Gal-T6, Beta-1,4-galactosyltransferase 6, Beta-1,4-GalTase 6, Beta4Gal-T6, EC:2.4.1.-

• 

  WB analysis using 87222-2-RR (same clone as 87222-2-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 87222-2-RR (B4GALT6 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 87222-2-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Product Information

87222-2-PBS targets B4GALT6 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag13686

  Product name: Recombinant human B4GALT6 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-382 aa of BC074884

  Sequence: MSVLRRMMRVSNRSLLAFIFFFSLSSSCLYFIYVAPGIANTYLFMVQARGIMLRENVKTIGHMIRLYTNKNSTLNGTDYPEGNNSSDYLVQTTTYLPENFTYSPYLPCPEKLPYMRGFLNVNVSEVSFDEIHQLFSKDLDIEPGGHWRPKDCKPRWKVAVLIPFRNRHEHLPIFFLHLIPMLQKQRLEFAFYVIEQTGTQPFNRAMLFNVGFKEAMKDSVWDCVIFHDVDHLPENDRNYYGCGEMPRHFAAKLDKYMYILPYKEFFGGVSGLTVEQFRKINGFPNAFWGWGGEDDDLWNRVHYAGYNVTRPEGDLGKYKSIPHHHRGEVQFLGRYKLLRYSKERQYIDGLNNLIYRPKILVDRLYTNISVNLMPELAPIEDY

• Full Name: UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 6
• Calculated Molecular Weight: 382 aa, 45 kDa
• Observed Molecular Weight: 45-60 kDa
• GenBank Accession Number: BC074884
• Gene Symbol: B4GALT6
• Gene ID (NCBI): 9331
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9UBX8
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

B4GALT6 encodes for a type II membrane-bound glycoprotein, which plays a crucial role in lactosylceramide synthesis by transferring galactose from UDP-galactose to glucosylceramide. B4GALT6 in astrocytes boosts CNS inflammation and promote neurodegeneration during chronic CNS inflammation (PMID: 25216636). Abnormal interactions of glycosyltransferases/glycosidases such as B4GALT6 can cause imbalances in key glycosylation modifications, thereby driving the disease process through a triple cascade reaction (PMID: 41112602).