Mouse CD86 Recombinant monoclonal antibody, PBS Only

• 

  IF Staining of RAW 264.7 using 83213-1-RR (same clone as 83213-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed RAW 264.7 cells using CD86 antibody (83213-1-RR, Clone: 230476B2 ) at dilution of 1:250 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 83213-1-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 83213-1-RR

  Biolayer interferometry (BLl) kinetic assays of 83213-1-RR against Mouse CD86 were performed. The affinity constant is 0.747 nM.

CD86 Uni-rAb^® Recombinant Antibody for IF/ICC, Indirect ELISA

Cat No. 83213-1-PBS

Clone No.230476B2

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

IF/ICC, Indirect ELISA

Synonyms

230476B2, B7, B7 2, B7.2, B70

---

Product Information

83213-1-PBS targets CD86 in IF/ICC, Indirect ELISA applications and shows reactivity with mouse samples.

• Tested Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg0802

  Product name: Recombinant Mouse CD86 protein (His Tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

  Tag: C-6*HIS

  Domain: 24-245 aa of NM_019388

  Sequence: VSVETQAYFNGTAYLPCPFTKAQNISLSELVVFWQDQQKLVLYEHYLGTEKLDSVNAKYLGRTSFDRNNWTLRLHNVQIKDMGSYDCFIQKKPPTGSIILQQTLTELSVIANFSEPEIKLAQNVTGNSGINLTCTSKQGHPKPKKMYFLITNSTNEYGDNMQISQDNVTELFSISNSLSLSFPDGVWHMTVVCVLETESMKISSKPLNFTQEFPSPQTYWKE

• Full Name: CD86 antigen
• Calculated Molecular Weight: 35 kDa
• GenBank Accession Number: NM_019388
• Gene Symbol: Cd86
• Gene ID (NCBI): 12524
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P42082-1
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.