Filter: AllWBIHCIF-P

WB analysis of HEK-293 using 66481-1-Ig (same clone as 66481-1-PBS)
HEK-293, PC-3, LNCaP, HeLa cells, and human spleen, human placenta, pig spleen tissues were subjected to SDS PAGE followed by western blot with 66481-1-Ig (B7-H3/CD276 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66481-1-PBS in a different storage buffer formulation.
WB analysis of HEK-293 using 66481-1-Ig (same clone as 66481-1-PBS)
WB result of B7-H3/CD276 antibody (66481-1-Ig; 1:40000; incubated at room temperature for 1.5 hours) with normal HEK-293 (sh-control ) and three independent sh-B7-H3 transfected HEK-293 cells. This data was developed using the same antibody clone with 66481-1-PBS in a different storage buffer formulation.
WB analysis of A431 using 66481-1-Ig (same clone as 66481-1-PBS)
Untreated and PNGase F-treated lysates of A431 cells and PC-3 cells were subjected to SDS PAGE followed by western blot with 66481-1-Ig (B7-H3/CD276 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. PNGase F was obtained from Atagenix (cat.NO. ata808). This data was developed using the same antibody clone with 66481-1-PBS in a different storage buffer formulation.
IHC staining of human tonsillitis using 66481-1-Ig (same clone as 66481-1-PBS)
Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 66481-1-Ig (B7-H3/CD276 antibody) at dilution of 1:5000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66481-1-PBS in a different storage buffer formulation.
IHC staining of human tonsillitis using 66481-1-Ig (same clone as 66481-1-PBS)
Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 66481-1-Ig (B7-H3/CD276 antibody) at dilution of 1:5000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66481-1-PBS in a different storage buffer formulation.
IHC staining of human tonsillitis using 66481-1-Ig (same clone as 66481-1-PBS)
Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 66481-1-Ig (B7-H3/CD276 antibody) at dilution of 1:5000 (under 4x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66481-1-PBS in a different storage buffer formulation.
IHC staining of human placenta using 66481-1-Ig (same clone as 66481-1-PBS)
Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 66481-1-Ig (B7-H3/CD276 antibody at dilution of 1:750 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66481-1-PBS in a different storage buffer formulation.
IHC staining of human placenta using 66481-1-Ig (same clone as 66481-1-PBS)
Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 66481-1-Ig (B7-H3/CD276 antibody at dilution of 1:750 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66481-1-PBS in a different storage buffer formulation.
IHC staining of human prostate cancer using 66481-1-Ig (same clone as 66481-1-PBS)
Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 66481-1-Ig (B7-H3/CD276 antibody at dilution of 1:300 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66481-1-PBS in a different storage buffer formulation.
IHC staining of human prostate cancer using 66481-1-Ig (same clone as 66481-1-PBS)
Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 66481-1-Ig (B7-H3/CD276 antibody at dilution of 1:300 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66481-1-PBS in a different storage buffer formulation.
IHC staining of human lung cancer using 66481-1-Ig (same clone as 66481-1-PBS)
Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 66481-1-Ig (B7-H3/CD276 antibody at dilution of 1:300 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66481-1-PBS in a different storage buffer formulation.
IHC staining of human lung cancer using 66481-1-Ig (same clone as 66481-1-PBS)
Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 66481-1-Ig (B7-H3/CD276 antibody at dilution of 1:300 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66481-1-PBS in a different storage buffer formulation.
IF Staining of human placenta using 66481-1-Ig (same clone as 66481-1-PBS)
Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded human placenta tissue using B7-H3/CD276 antibody (66481-1-Ig, Clone: 1E7D1 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L) (SA00013-1). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66481-1-PBS in a different storage buffer formulation.
×
Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded human placenta tissue using B7-H3/CD276 antibody (66481-1-Ig, Clone: 1E7D1 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L) (SA00013-1). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66481-1-PBS in a different storage buffer formulation.

Featured Product
KD/KO Validated

B7-H3 Monoclonal antibody, PBS Only

B7-H3 Monoclonal Antibody for WB, IHC, IF-P, Indirect ELISA

Cat No. 66481-1-PBS

Clone No.1E7D1

Review Product

Host / Isotype

Mouse / IgG2a

Reactivity

human, pig

Applications

WB, IHC, IF-P, Indirect ELISA

Synonyms

CD276, B7H3, B7 homolog 3, B7 H3, 4Ig-B7-H3

Formulation: PBS Only

PBS and Azide

PBS Only

Conjugate: Unconjugated

Size/Concentration:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Overview

Tested Applications
Product Information

Print datasheet

MSDS SDS

Product Information

66481-1-PBS targets B7-H3 in WB, IHC, IF-P, Indirect ELISA applications and shows reactivity with human, pig samples.

Tested Reactivity	human, pig
Host / Isotype	Mouse / IgG2a
Class	Monoclonal
Type	Antibody
Immunogen	CatNo: Ag6006 Product name: Recombinant human CD276 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 41-181 aa of BC062581 Sequence: LVGTDATLCCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFAEGQDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYQGYPEAEVFWQDG Predict reactive species
Full Name	CD276 molecule
Calculated Molecular Weight	57 kDa
Observed Molecular Weight	100 kDa
GenBank Accession Number	BC062581
Gene Symbol	CD276
Gene ID (NCBI)	80381
RRID	AB_2881847
Conjugate	Unconjugated
Form	Liquid
Purification Method	Protein A purification
UNIPROT ID	Q5ZPR3
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.

Background Information

B7-H3 (CD276) is a type I transmembrane protein expressed on many tissues and cell types. B7-H3 is a 100-kDa glycoprotein that belongs to the B7 immunoregulatory family and participates in the regulation of T-cell-mediated immune response probably by functioning as both a T cell costimulator and coinhibitor (PMID: 25567370; 20696859). Overexpressed on a wide range of human solid cancers, B7-H3 has been implicated in cancer progression and metastasis and becomes an attractive target for cancer immunotherapy (PMID: 27208063).