• Featured Product
  • KD/KO Validated

CoraLite®594-conjugated B7-H3/CD276 Monoclonal antibody

B7-H3/CD276 Monoclonal Antibody for IF-P
Cat No. CL594-66481
Clone No.1E7D1

Host / Isotype

Mouse / IgG2a

Reactivity

Human, Pig

Applications

IF-P

4Ig B7 H3, B7 H3, B7 homolog 3, B7H3, B7-H3, CD276, CD276 antigen, CD276 molecule, Costimulatory molecule, UNQ309/PRO352

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  CoraLite®594
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF-P detected inhuman tonsillitis tissue

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)-PIF-P : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL594-66481 targets B7-H3/CD276 in IF-P applications and shows reactivity with Human, Pig samples.

Tested Reactivity Human, Pig
Host / Isotype Mouse / IgG2a
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag6006

Product name: Recombinant human CD276 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 41-181 aa of BC062581

Sequence: LVGTDATLCCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFAEGQDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYQGYPEAEVFWQDG

Predict reactive species
Full Name CD276 molecule
Calculated Molecular Weight 57 kDa
Observed Molecular Weight 100 kDa
GenBank Accession NumberBC062581
Gene Symbol CD276
Gene ID (NCBI) 80381
RRIDAB_2883588
Conjugate CoraLite®594 Fluorescent Dye
Excitation/Emission Maxima Wavelengths588 nm / 604 nm
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ5ZPR3
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

B7-H3 (CD276) is a type I transmembrane protein expressed on many tissues and cell types. B7-H3 is a 100-kDa glycoprotein that belongs to the B7 immunoregulatory family and participates in the regulation of T-cell-mediated immune response probably by functioning as both a T cell costimulator and coinhibitor (PMID: 25567370; 20696859). Overexpressed on a wide range of human solid cancers, B7-H3 has been implicated in cancer progression and metastasis and becomes an attractive target for cancer immunotherapy (PMID: 27208063).

Protocols

Product Specific Protocols
IF protocol for CL594 B7-H3/CD276 antibody CL594-66481Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...