• Featured Product
  • KD/KO Validated

CoraLite® Plus 488-conjugated BAG6 Polyclonal antibody

BAG6 Polyclonal Antibody for IF/ICC, FC (Intra)
Cat No. CL488-26417

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF/ICC, FC (Intra)

BAG 6, BAG6, BAT3, D6S52E, G3, HLA B associated transcript 3, Protein G3

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHeLa cells
Positive FC (Intra) detected inHeLa cells
Positive FC detected inHeLa cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension
Flow Cytometry (FC)FC : 0.80 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-26417 targets BAG6 in IF/ICC, FC (Intra) applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag24525

Product name: Recombinant human BAG6 protein

Source: e coli.-derived, PET30a

Tag: 6*His

Domain: 1-184 aa of BC003133

Sequence: MEPNDSTSTAVEEPDSLEVLVKTLDSQTRTFIVGAQMNVKEFKEHIAASVSIPSEKQRLIYQGRVLQDDKKLQEYNVGGKVIHLVERAPPQTHLPSGASSGTGSASATHGGGSPPGTRGPGASVHDRNANSYVMVGTFNLPSDGSAVDVHINMEQAPIQSEPRVRLVMAQHMIRDIQTLLSRME

Predict reactive species
Full Name HLA-B associated transcript 3
Calculated Molecular Weight 119 kDa
Observed Molecular Weight 150 kDa
GenBank Accession NumberBC003133
Gene Symbol BAT3/BAG-6
Gene ID (NCBI) 7917
RRIDAB_3672797
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
Excitation LaserBlue laser (488 nm)
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP46379
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

BAT3 also known as Scythe or BAG6, is a nuclear protein implicated in the control of apoptosis and natural killer (NK) cell-dendritic cell (DC) interaction. BAT3 was first discovered as a member of a group of genes located within the class III region of the human major histocompatibility complex on chromosome 6, and has been extensively studied for its role in regulating apoptosis under various stress conditions such as DNA damage and endoplasmic reticulum-related stress. BAT3 has been shown to be required for p53 acetylation, which is critical for the enhancement of p53 transcriptional activity in response to DNA damage. In addition, BAT3 is involved in the regulation of development and reproduction of mammals by acting as a co-chaperone of the heat shock protein HSP70.

Protocols

Product Specific Protocols
FC protocol for CL Plus 488 BAG6 antibody CL488-26417Download protocol
IF protocol for CL Plus 488 BAG6 antibody CL488-26417Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...