BCHE Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• BCHE Polyclonal antibody, PBS Only (23854-1-PBS)

• 

  WB analysis of HeLa using 23854-1-AP (same clone as 23854-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 23854-1-AP (BCHE Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 23854-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HEK-293 using 23854-1-AP (same clone as 23854-1-PBS)

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 23854-1-AP (BCHE Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 23854-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver using 23854-1-AP (same clone as 23854-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 23854-1-AP (BCHE Antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 23854-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver using 23854-1-AP (same clone as 23854-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 23854-1-AP (BCHE Antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 23854-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 23854-1-AP (same clone as 23854-1-PBS)

  Immunofluorescent analysis of (-20°C Methanol) fixed HeLa cells using BCHE antibody (23854-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 23854-1-PBS in a different storage buffer formulation.

BCHE Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 23854-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

---

Product Information

23854-1-PBS targets BCHE in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag20888

  Product name: Recombinant human BCHE protein

  Source: e coli.-derived, PET30a

  Tag: 6*His

  Domain: 539-602 aa of BC008396

  Sequence: MTKLRAQQCRFWTSFFPKVLEMTGNIDEAEWEWKAGFHRWNNYMMDWKNQFNDYTSKKESCVGL

• Full Name: butyrylcholinesterase
• Calculated Molecular Weight: 602 aa, 68 kDa
• Observed Molecular Weight: 85-90 kDa
• GenBank Accession Number: BC008396
• Gene Symbol: BCHE
• Gene ID (NCBI): 590
• RRID: AB_2879341
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen Affinity purified
• UNIPROT ID: P06276
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

BCHE(butyrylcholinesterase) is an enzyme expressed in most human tissues. It may have a greater role in cholinergic transmission than previously surmised, making BChE inhibition an important therapeutic goal in Alzheimer's disease(PMID:11848688). BCHE is also named as CHE1 and belongs to the type-B carboxylesterase/lipase family. This is a glycoprotein with the molecular weight from 68 kDa to 90 kDa.