Product Information
23854-1-PBS targets BCHE in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag20888 Product name: Recombinant human BCHE protein Source: e coli.-derived, PET30a Tag: 6*His Domain: 539-602 aa of BC008396 Sequence: MTKLRAQQCRFWTSFFPKVLEMTGNIDEAEWEWKAGFHRWNNYMMDWKNQFNDYTSKKESCVGL Predict reactive species |
| Full Name | butyrylcholinesterase |
| Calculated Molecular Weight | 602 aa, 68 kDa |
| Observed Molecular Weight | 85-90 kDa |
| GenBank Accession Number | BC008396 |
| Gene Symbol | BCHE |
| Gene ID (NCBI) | 590 |
| RRID | AB_2879341 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen Affinity purified |
| UNIPROT ID | P06276 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
BCHE(butyrylcholinesterase) is an enzyme expressed in most human tissues. It may have a greater role in cholinergic transmission than previously surmised, making BChE inhibition an important therapeutic goal in Alzheimer's disease(PMID:11848688). BCHE is also named as CHE1 and belongs to the type-B carboxylesterase/lipase family. This is a glycoprotein with the molecular weight from 68 kDa to 90 kDa.









