BCL2L14 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• BCL2L14 Polyclonal antibody, PBS Only (12846-1-PBS)

• 

  WB analysis of A549 using 12846-1-AP

  A549 cells were subjected to SDS PAGE followed by western blot with 12846-1-AP (BCL2L14 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human lung using 12846-1-AP (same clone as 12846-1-PBS)

  human lung tissue were subjected to SDS PAGE followed by western blot with 12846-1-AP (BCL2L14 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12846-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human prostate cancer using 12846-1-AP (same clone as 12846-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human prostate cancer using 12846-1-AP (BCL2L14 antibody) at dilution of 1:100 (under 10x lens). This data was developed using the same antibody clone with 12846-1-PBS in a different storage buffer formulation.

• 

  IF Staining of MCF-7 using 12846-1-AP (same clone as 12846-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed MCF-7 cells using 12846-1-AP (BCL2L14 antibody) at dilution of 1:50 and Alexa Fluor 488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 12846-1-PBS in a different storage buffer formulation.

• 

  FC experiment of Jurkat using 12846-1-AP (same clone as 12846-1-PBS)

  1x10^6 Jurkat cells were intracellularly stained with 0.4 ug BCL2L14 Polyclonal antibody (12846-1-AP) and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2)(red), or 0.4 ug Rabbit IgG control Rabbit PolyAb (30000-0-AP) (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer. This data was developed using the same antibody clone with 12846-1-PBS in a different storage buffer formulation.

BCL2L14 Polyclonal Antibody for WB, IHC, IF/ICC, FC (Intra), ELISA

Cat No. 12846-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, FC (Intra), ELISA

Synonyms

---

Product Information

12846-1-PBS targets BCL2L14 in WB, IHC, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3926

  Product name: Recombinant human BCL2L14 protein

  Source: e coli.-derived, T-HIS

  Tag: 6*His

  Domain: 1-327 aa of BC025778

  Sequence: MCSTSGCDLEEIPLDDDDLNTIEFKILAYYTRHHVFKSTPALFSPKLLRTRSLSQRGLGNCSANESWTEVSWPCRNSQSSEKAINLGKKKSSWKAFFGVVEKEDSQSTPAKVSAQGQRTLEYQDSHSQQWSRCLSNVEQCLEHEAVDPKVISIANRVAEIVYSWPPPQATQAGGFKSKEIFVTEGLSFQLQGHVPVASSSKKDEEEQILAKIVELLKYSGDQLERKLKKDKALMGHFQDGLSYSVFKTITDQVLMGVDPRGESEVKAQGFKAALVIDVTAKLTAIDNHPMNRVLGFGTKYLKENFSPWIQQHGGWEKILGISHEEVD

• Full Name: BCL2-like 14 (apoptosis facilitator)
• Calculated Molecular Weight: 327 aa, 37 kDa
• Observed Molecular Weight: 37 kDa
• GenBank Accession Number: BC025778
• Gene Symbol: BCL2L14
• Gene ID (NCBI): 79370
• RRID: AB_2290479
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9BZR8
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.