BEX1/2 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• BEX1/2 Polyclonal antibody, PBS Only (12390-1-PBS)

• 

  WB analysis of human brain using 12390-1-AP (same clone as 12390-1-PBS)

  human brain tissue were subjected to SDS PAGE followed by western blot with 12390-1-AP (BEX1/2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12390-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human medulloblastoma using 12390-1-AP (same clone as 12390-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human medulloblastoma using 12390-1-AP (BEX1/2 antibody) at dilution of 1:100 (under 10x lens). This data was developed using the same antibody clone with 12390-1-PBS in a different storage buffer formulation.

BEX1/2 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 12390-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, Indirect ELISA

Synonyms

BEX2, Brain-expressed X-linked protein 2, hBex2

---

Product Information

12390-1-PBS targets BEX1/2 in WB, IHC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3066

  Product name: Recombinant human BEX2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-128 aa of BC015522

  Sequence: MESKEERALNNLIVENVNQENDEKDEKEQVANKGEPLALPLNVSEYCVPRGNRRRFRVRQPILQYRWDIMHRLGEPQARMREENMERIGEEVRQLMEKLREKQLSHSLRAVSTDPPHHDHHDEFCLMP

• Full Name: brain expressed X-linked 2
• Calculated Molecular Weight: 128 aa, 15 kDa
• Observed Molecular Weight: 10-15 kDa
• GenBank Accession Number: BC015522
• Gene Symbol: BEX2
• Gene ID (NCBI): 84707
• RRID: AB_10644326
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9BXY8
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

BEX1 is a signaling adapter molecule involved in p75NTR/NGFR signaling. It lays a role in cell cycle progression and neuronal differentiation. BEX1 inhibits neuronal differentiation in response to nerve growth factor (NGF). BEX2 is a regulator of mitochondrial apoptosis and G1 cell cycle in breast cancer. It regulates the level of PP2A regulatory subunit B and PP2A phosphatase activity. The homology between human BEX1 and BEX2 is 94%. This antibody detects both BEX1 and BEX2.