BIVM Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• BIVM Polyclonal antibody, PBS Only (25432-1-PBS)

• 

  WB analysis of Raji using 25432-1-AP (same clone as 25432-1-PBS)

  Raji cells were subjected to SDS PAGE followed by western blot with 25432-1-AP (BIVM Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 25432-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human ovary using 25432-1-AP (same clone as 25432-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human ovary tissue slide using 25432-1-AP (BIVM Antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 25432-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human pancreas cancer using 25432-1-AP (same clone as 25432-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 25432-1-AP (BIVM antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 25432-1-PBS in a different storage buffer formulation.

BIVM Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 25432-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, Indirect ELISA

Synonyms

---

Product Information

25432-1-PBS targets BIVM in WB, IHC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag22087

  Product name: Recombinant human BIVM protein

  Source: e coli.-derived, PET30a

  Tag: 6*His

  Domain: 411-503 aa of BC075084

  Sequence: LHCIIAFQRLNWQRFGLWNFPFGTIRQESQPPTHAQGIAKSESEDNISKKQHGRLGRSFSASFHQDSAWKKMSSIHERRNSGYQGYSDYDGND

• Full Name: basic, immunoglobulin-like variable motif containing
• Calculated Molecular Weight: 503 aa, 57 kDa
• Observed Molecular Weight: 32 kDa
• GenBank Accession Number: BC075084
• Gene Symbol: BIVM
• Gene ID (NCBI): 54841
• RRID: AB_2880076
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q86UB2
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

BIVM has been identified using an electronic search based on the conservation of short sequence motifs within the variable region of immunoglobulin (Ig) genes. It is tightly linked (41 bp) and in the opposite transcriptional orientation to MGC5302 (also known as KDEL1 and EP58) in human. BIVM has two isoforms with MW 57 kDa and 32 kDa.