BMPR1A Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• BMPR1A Polyclonal antibody, PBS Only (12702-1-PBS)

• 

  WB analysis using 12702-1-AP (same clone as 12702-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 12702-1-AP (BMPR1A antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12702-1-PBS in a different storage buffer formulation.

• 

  WB analysis of MCF-7 using 12702-1-AP (same clone as 12702-1-PBS)

  WB result of BMPR1A antibody (12702-1-AP; 1:600; incubated at room temperature for 1.5 hours) with sh-Control and sh-BMPR1A transfected MCF-7 cells. This data was developed using the same antibody clone with 12702-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human skeletal muscle using 12702-1-AP (same clone as 12702-1-PBS)

  human skeletal muscle tissue were subjected to SDS PAGE followed by western blot with 12702-1-AP (BMPR1A Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12702-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human heart using 12702-1-AP (same clone as 12702-1-PBS)

  human heart tissue were subjected to SDS PAGE followed by western blot with 12702-1-AP (BMPR1A Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12702-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HEK-293 using 12702-1-AP (same clone as 12702-1-PBS)

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 12702-1-AP (BMPR1A Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12702-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse liver using 12702-1-AP (same clone as 12702-1-PBS)

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 12702-1-AP (BMPR1A antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12702-1-PBS in a different storage buffer formulation.

• 

  IP experiment of HEK-293 using 12702-1-AP (same clone as 12702-1-PBS)

  IP result of anti-BMPR1A (IP:12702-1-AP, 4ug; Detection:12702-1-AP 1:500) with HEK-293 cells lysate 2000ug. This data was developed using the same antibody clone with 12702-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 12702-1-AP (same clone as 12702-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using BMPR1A antibody (12702-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 12702-1-PBS in a different storage buffer formulation.

• 

  IF Staining of U2OS using 12702-1-AP (same clone as 12702-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed U2OS cells using BMPR1A antibody (12702-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 12702-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

BMPR1A Polyclonal Antibody for WB, IF/ICC, IP, Indirect ELISA

Cat No. 12702-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IF/ICC, IP, Indirect ELISA

Synonyms

Activin receptor like kinase 3, Activin receptor-like kinase 3, ACVRLK3, ALK 3, ALK3

---

Product Information

12702-1-PBS targets BMPR1A in WB, IF/ICC, IP, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3410

  Product name: Recombinant human BMPR1A protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 174-427 aa of BC028383

  Sequence: FCYKHYCKSISSRRRYNRDLEQDEAFIPVGESLKDLIDQSQSSGSGSGLPLLVQRTIAKQIQMVRQVGKGRYGEVWMGKWRGEKVAVKVFFTTEEASWFRETEIYQTVLMRHENILGFIAADIKGTGSWTQLYLITDYHENGSLYDFLKCATLDTRALLKLAYSAACGLCHLHTEIYGTQGKPAIAHRDLKSKNILIKKNGSCCIADLGLAVKFNSDTNEVDVPLNTRVGTKRYMAPEVLDESLNKNHFQPYIM

• Full Name: bone morphogenetic protein receptor, type IA
• Calculated Molecular Weight: 532 aa, 60 kDa
• Observed Molecular Weight: 60-68 kDa
• GenBank Accession Number: BC028383
• Gene Symbol: BMPR1A
• Gene ID (NCBI): 657
• RRID: AB_2064273
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P36894
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.