CoraLite® Plus 488-conjugated BNIP3L Monoclonal antibody

BNIP3L Monoclonal Antibody for IF/ICC, FC (Intra)
Cat No. CL488-68118
Clone No.1F6A3

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

IF/ICC, FC (Intra)

1F6A3, Adenovirus E1B19K-binding protein B5, BCL2/adenovirus E1B 19 kDa protein-interacting protein 3A, BNIP3A, BNIP3H

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHeLa cells
Positive FC (Intra) detected inHeLa cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-68118 targets BNIP3L in IF/ICC, FC (Intra) applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag31547

Product name: Recombinant human BNIP3L protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 77-146 aa of BC001559

Sequence: DAQHESGQSSSRGSSHCDSPSPQEDGQIMFDVEMHTSRDHSSQSEEEVVEGEKEVEALKKSADWVSDWSS

Predict reactive species
Full Name BCL2/adenovirus E1B 19kDa interacting protein 3-like
Calculated Molecular Weight 24 kDa
Observed Molecular Weight35 kD
GenBank Accession NumberBC001559
Gene Symbol BNIP3L
Gene ID (NCBI) 665
RRIDAB_3672971
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodProtein G purification
UNIPROT IDO60238
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

BNIP3L, also named as BNIP3A, BNIP3H, NIX and NIP3L. Bnip3L is one of the BH3-containing pro-apoptotic proteins and that it targets the mitochondria when inducing apoptosis. It may function as a tumor suppressor. BNIP3L has Dimer form with MW ~70 kDa.

Protocols

Product Specific Protocols
FC protocol for CL Plus 488 BNIP3L antibody CL488-68118Download protocol
IF protocol for CL Plus 488 BNIP3L antibody CL488-68118Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...