BOLA2 Polyclonal antibody, PBS Only

Name: BOLA2 Polyclonal antibody, PBS Only,
Brand: Proteintech

BOLA2 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 26080-1-PBS

Review Product

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

BOLA2A, BOLA2B, BolA-like protein 2, My016

Formulation: PBS Only

PBS, Azide, Glycerol

Conjugate: Unconjugated

Size/Concentration:

SKU:

Freight/Packing: -

Quantity

- +

Filter: AllWB

WB analysis of HepG2 using 26080-1-AP (same clone as 26080-1-PBS)
HepG2 cells were subjected to SDS PAGE followed by western blot with 26080-1-AP (BOLA2 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 26080-1-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of human testis using 26080-1-AP (same clone as 26080-1-PBS)
human testis tissue were subjected to SDS PAGE followed by western blot with 26080-1-AP (BOLA2 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 26080-1-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for BOLA2 in ?

26080-1-PBS targets BOLA2 in WB, Indirect ELISA applications and shows reactivity with human samples.

Tested Reactivity	human
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag23260 Product name: Recombinant human BOLA2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-104 aa of BC130403 Sequence: MASAKSLDRWKARLLEGGSTALTYALVRAEVSFPAEVAPVRQQGSVAGARAGVVSLLGCRSSWTAAMELSAEYLREKLQRDLEAEHVEVEDTTLNRCSCSFRVL Predict reactive species
Full Name	bolA homolog 2 (E. coli)
Observed Molecular Weight	7 kDa
GenBank Accession Number	BC130403
Gene Symbol	BOLA2
Gene ID (NCBI)	552900
RRID	AB_2880367
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	Q9H3K6
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.