BOLA2 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• BOLA2 Polyclonal antibody, PBS Only (26080-1-PBS)

• 

  WB analysis of HepG2 using 26080-1-AP (same clone as 26080-1-PBS)

  HepG2 cells were subjected to SDS PAGE followed by western blot with 26080-1-AP (BOLA2 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 26080-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human testis using 26080-1-AP (same clone as 26080-1-PBS)

  human testis tissue were subjected to SDS PAGE followed by western blot with 26080-1-AP (BOLA2 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 26080-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

BOLA2 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 26080-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

---

Product Information

26080-1-PBS targets BOLA2 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag23260

  Product name: Recombinant human BOLA2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-104 aa of BC130403

  Sequence: MASAKSLDRWKARLLEGGSTALTYALVRAEVSFPAEVAPVRQQGSVAGARAGVVSLLGCRSSWTAAMELSAEYLREKLQRDLEAEHVEVEDTTLNRCSCSFRVL

• Full Name: bolA homolog 2 (E. coli)
• Observed Molecular Weight: 7 kDa
• GenBank Accession Number: BC130403
• Gene Symbol: BOLA2
• Gene ID (NCBI): 552900
• RRID: AB_2880367
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9H3K6
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.