• Featured Product
  • KD/KO Validated

Beta Tubulin Recombinant monoclonal antibody, PBS Only

Beta Tubulin Uni-rAb® Recombinant Antibody for WB, IHC, IF/ICC, IF-P, FC (Intra), IP, Indirect ELISA
Cat No. 80713-1-PBS
Clone No.2O13

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat, zebrafish

Applications

WB, IHC, IF/ICC, IF-P, FC (Intra), IP, Indirect ELISA

Tubulin beta 3 chain, Tubulin beta III, β III tubulin , βIII tubulin , 2O13

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

80713-1-PBS targets Beta Tubulin in WB, IHC, IF/ICC, IF-P, FC (Intra), IP, Indirect ELISA applications and shows reactivity with human, mouse, rat, zebrafish samples.

Tested Reactivity human, mouse, rat, zebrafish
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag0117

Product name: Recombinant human Tubulin-beta protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 44-259 aa of BC000748

Sequence: LERISVYYNEASSHKYVPRAILVDLEPGTMDSVRSGAFGHLFRPDNFIFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKECENCDCLQGFQLTHSLGGGTGSGMGTLLISKVREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSIHQLVENTDETYCIDNEALYDICFRTLKLATPTYGDLNHLVSATMSGVTTSLRFPGQLNADLRKLAVNMVP

Predict reactive species
Full Name tubulin, beta 3
Calculated Molecular Weight 450 aa, 50 kDa
Observed Molecular Weight50-55 kDa
GenBank Accession NumberBC000748
Gene Symbol TUBB3
Gene ID (NCBI) 10381
RRIDAB_2918906
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ13509
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

There are five tubulins in human cells: alpha, beta, gamma, delta, and epsilon. Tubulins are conserved across species. They form heterodimers, which multimerize to form a microtubule filament. An alpha and beta tubulin heterodimer is the basic structural unit of microtubules. The heterodimer does not come apart, once formed. The alpha and beta tubulins, which are each about 55 kDa MW, are homologous but not identical. Alpha, beta, and gamma tubulins have all been used as loading controls. Tubulin expression may vary according to resistance to antimicrobial and antimitotic drugs.

Loading...
||
New chat Able
正在加载,请稍候...