Tested Applications
| Positive WB detected in | HeLa cells, HEK-293 cells, zebrafish tissue, Jurkat cells, K-562 cells, Hsc-T6 cells, NIH/3T3 cells, mouse brain, rat brain |
| Positive IP detected in | HEK-293 cells |
| Positive IHC detected in | human colon tissue, rat brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | mouse eye tissue |
| Positive IF/ICC detected in | C2C12 cells, HeLa cells, HepG2 cells |
| Positive FC (Intra) detected in | HEK-293 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:500-1:2000 |
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:250-1:1000 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.20 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 11 publications below |
| IF | See 3 publications below |
Product Information
80713-1-RR targets Beta Tubulin in WB, IHC, IF/ICC, IF-P, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat, zebrafish samples.
| Tested Reactivity | human, mouse, rat, zebrafish |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag0117 Product name: Recombinant human Tubulin-beta protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 44-259 aa of BC000748 Sequence: LERISVYYNEASSHKYVPRAILVDLEPGTMDSVRSGAFGHLFRPDNFIFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKECENCDCLQGFQLTHSLGGGTGSGMGTLLISKVREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSIHQLVENTDETYCIDNEALYDICFRTLKLATPTYGDLNHLVSATMSGVTTSLRFPGQLNADLRKLAVNMVP Predict reactive species |
| Full Name | tubulin, beta 3 |
| Calculated Molecular Weight | 450 aa, 50 kDa |
| Observed Molecular Weight | 50-55 kDa |
| GenBank Accession Number | BC000748 |
| Gene Symbol | TUBB3 |
| Gene ID (NCBI) | 10381 |
| RRID | AB_2918906 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | Q13509 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
There are five tubulins in human cells: alpha, beta, gamma, delta, and epsilon. Tubulins are conserved across species. They form heterodimers, which multimerize to form a microtubule filament. An alpha and beta tubulin heterodimer is the basic structural unit of microtubules. The heterodimer does not come apart, once formed. The alpha and beta tubulins, which are each about 55 kDa MW, are homologous but not identical. Alpha, beta, and gamma tubulins have all been used as loading controls. Tubulin expression may vary according to resistance to antimicrobial and antimitotic drugs.
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for Beta Tubulin antibody 80713-1-RR | Download protocol |
| IF protocol for Beta Tubulin antibody 80713-1-RR | Download protocol |
| IHC protocol for Beta Tubulin antibody 80713-1-RR | Download protocol |
| IP protocol for Beta Tubulin antibody 80713-1-RR | Download protocol |
| WB protocol for Beta Tubulin antibody 80713-1-RR | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
The Anti-Atherosclerotic Effects of Buyang Huanwu Decoction through M1 and M2 Macrophage Polarization in an ApoE Knockout Mouse Model | ||
Cells Fabrication Scaffold with High Dimensional Control for Spheroids with Undifferentiated iPS Cell Properties | ||
Mol Cell The RNA-stability-independent role of the RNA m6A reader YTHDF2 in promoting protein translation to confer tumor chemotherapy resistance | ||
Commun Biol Whole genome sequencing identifies pathogenic genetic variants in Han Chinese patients with familial venous thromboembolism | ||
Neurobiol Pain Keratinocyte-derived extracellular vesicles in painful diabetic neuropathy | ||
J Med Chem Discovery of Novel Oxazolo[4,3-f]purine Derivatives as Antitumor Agents through PPIA Interaction |

































